Scaffold Ga0136159_1071848

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136159_1071848

Scaffold Ga0136159_1071848

Overview

Basic Information
Taxon OID	3300010217 Open in IMG/M
Scaffold ID	Ga0136159_1071848 Open in IMG/M
Source Dataset Name	Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China ? Region2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DNAVision
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	779
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Henan Dengzhou, China - Region2

Source Dataset Sampling Location
Location Name	Henan Dengzhou, China
Coordinates	Lat. (^o)	32.68	Long. (^o)	112.08	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136159_10718481	F029983	GAG	VSLCCIEVYKWVAVMVGVKFEFNDIIPLHKKKRFW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.