Scaffold Ga0136452_102661

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136452_102661

Scaffold Ga0136452_102661

Overview

Basic Information
Taxon OID	3300010212 Open in IMG/M
Scaffold ID	Ga0136452_102661 Open in IMG/M
Source Dataset Name	Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCS17a
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13470
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities

Source Dataset Sampling Location
Location Name	Lake Waban, Wellesley MA
Coordinates	Lat. (^o)	42.2876	Long. (^o)	-71.30117	Alt. (m)		Depth (m)	.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017253	Metagenome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136452_1026611	F017253	N/A	YTQGRTASASWRMSSRKAARAESYSPKTTAADIDGY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.