3300010212: Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCS17a

Overview

Basic Information

• IMG/M Taxon OID: 3300010212
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0120452 | Gp0154471 | Ga0136452
• Sample Name: Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCS17a
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 90775574
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Phototrophic Microbial Communities
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater littoral zone → lake sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Lake Waban, Wellesley MA
• Coordinates
  • Lat. (^o): 42.2876
  • Long. (^o): -71.30117
  • Alt. (m): N/A
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017253	Metagenome	242	Y
F087946	Metagenome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0136452_100557	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	57801
Ga0136452_102661	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	13470

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0136452_100557	Ga0136452_10055729	F087946	MFAQKTDMLSKQRIPDLIVIVVLGLFLLLLNYTGHIGVISNYPFIFLLIMYFVGRGVTWYIINKNMQE*
Ga0136452_102661	Ga0136452_1026611	F017253	YTQGRTASASWRMSSRKAARAESYSPKTTAADIDGY*