| Basic Information | |
|---|---|
| Taxon OID | 3300010212 Open in IMG/M |
| Scaffold ID | Ga0136452_100557 Open in IMG/M |
| Source Dataset Name | Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCS17a |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 57801 |
| Total Scaffold Genes | 50 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (10.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Waban, Wellesley MA | |||||||
| Coordinates | Lat. (o) | 42.2876 | Long. (o) | -71.30117 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087946 | Metagenome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136452_10055729 | F087946 | N/A | MFAQKTDMLSKQRIPDLIVIVVLGLFLLLLNYTGHIGVISNYPFIFLLIMYFVGRGVTWYIINKNMQE* |
| ⦗Top⦘ |