Scaffold Ga0136452_100557

Overview

Basic Information

• Taxon OID: 3300010212
• Scaffold ID: Ga0136452_100557
• Source Dataset Name: Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCS17a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 57801
• Total Scaffold Genes: 50
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (10.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities

Source Dataset Sampling Location

• Location Name: Lake Waban, Wellesley MA
• Coordinates
  • Lat. (^o): 42.2876
  • Long. (^o): -71.30117
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087946	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136452_10055729	F087946	N/A	MFAQKTDMLSKQRIPDLIVIVVLGLFLLLLNYTGHIGVISNYPFIFLLIMYFVGRGVTWYIINKNMQE*