NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136458_103856

Scaffold Ga0136458_103856


Overview

Basic Information
Taxon OID3300010203 Open in IMG/M
Scaffold IDGa0136458_103856 Open in IMG/M
Source Dataset NameLittoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCF6TC3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1251
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities

Source Dataset Sampling Location
Location NameLake Waban, Wellesley MA
CoordinatesLat. (o)42.2876Long. (o)-71.30117Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017253Metagenome242Y

Sequences

Protein IDFamilyRBSSequence
Ga0136458_1038561F017253AGGAVRIAGDSYLTAKGGSSRKAAWAEGCPPKITAADLDG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.