| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010203 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120452 | Gp0154476 | Ga0136458 |
| Sample Name | Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCF6TC3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 43934860 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Phototrophic Microbial Communities |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater littoral zone → lake sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Waban, Wellesley MA | |||||||
| Coordinates | Lat. (o) | 42.2876 | Long. (o) | -71.30117 | Alt. (m) | N/A | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017253 | Metagenome | 242 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0136458_103856 | Not Available | 1251 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0136458_103856 | Ga0136458_1038561 | F017253 | VRIAGDSYLTAKGGSSRKAAWAEGCPPKITAADLDG* |
| ⦗Top⦘ |