Scaffold Ga0136175_10050768

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136175_10050768

Scaffold Ga0136175_10050768

Overview

Basic Information
Taxon OID	3300010163 Open in IMG/M
Scaffold ID	Ga0136175_10050768 Open in IMG/M
Source Dataset Name	Cecal microbial community of the 13 lined ground squirrel in Duluth, Minnesota, USA. Combined Assembly of 10 SPs
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota - Twin Cities
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5217
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Ictidomys Tridecemlineatus Cecum → Ictidomys Tridecemlineatus (13 Lined Ground Squirrel) Cecal Microbiome

Source Dataset Sampling Location
Location Name	Duluth, Minnesota, USA
Coordinates	Lat. (^o)	46.7867	Long. (^o)	-92.100487	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084822	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136175_100507684	F084822	AGGAG	MPKGSYEENAYKWFKRKGYASKYEYPGIYCIKIDNDIVYIGKSHNMLKRVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.