| Basic Information | |
|---|---|
| Taxon OID | 3300010163 Open in IMG/M |
| Scaffold ID | Ga0136175_10050768 Open in IMG/M |
| Source Dataset Name | Cecal microbial community of the 13 lined ground squirrel in Duluth, Minnesota, USA. Combined Assembly of 10 SPs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota - Twin Cities |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5217 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Ictidomys Tridecemlineatus Cecum → Ictidomys Tridecemlineatus (13 Lined Ground Squirrel) Cecal Microbiome |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Duluth, Minnesota, USA | |||||||
| Coordinates | Lat. (o) | 46.7867 | Long. (o) | -92.100487 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084822 | Metagenome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136175_100507684 | F084822 | AGGAG | MPKGSYEENAYKWFKRKGYASKYEYPGIYCIKIDNDIVYIGKSHNMLKRVA* |
| ⦗Top⦘ |