Basic Information | |
---|---|
Taxon OID | 3300010163 Open in IMG/M |
Scaffold ID | Ga0136175_10029770 Open in IMG/M |
Source Dataset Name | Cecal microbial community of the 13 lined ground squirrel in Duluth, Minnesota, USA. Combined Assembly of 10 SPs |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Minnesota - Twin Cities |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8271 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Ictidomys Tridecemlineatus Cecum → Ictidomys Tridecemlineatus (13 Lined Ground Squirrel) Cecal Microbiome |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Duluth, Minnesota, USA | |||||||
Coordinates | Lat. (o) | 46.7867 | Long. (o) | -92.100487 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100155 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136175_100297706 | F100155 | AGGAGG | MTLQEMIYKRKSCRSFTNVPVEEDMIRIIRDFPLKPLYPDIQVRWDIVSRTEVKCICP* |
⦗Top⦘ |