Scaffold Ga0114967_10294722

Overview

Basic Information

• Taxon OID: 3300010160
• Scaffold ID: Ga0114967_10294722
• Source Dataset Name: Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 835
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Montjoie, Canada
• Coordinates
  • Lat. (^o): 45.4091
  • Long. (^o): -72.0994
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066584	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114967_102947221	F066584	N/A	QHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN*