| Basic Information | |
|---|---|
| Family ID | F066584 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKHSKYTEHGLDGPYLAPPTLVDKVLFWLSGFVSGLIFALLITGN |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 55.20 % |
| % of genes near scaffold ends (potentially truncated) | 38.89 % |
| % of genes from short scaffolds (< 2000 bps) | 76.98 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.444 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (54.762 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.810 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (80.159 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.51% β-sheet: 0.00% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF04404 | ERF | 32.54 |
| PF14549 | P22_Cro | 18.25 |
| PF09588 | YqaJ | 10.32 |
| PF07120 | DUF1376 | 3.17 |
| PF05772 | NinB | 1.59 |
| PF08291 | Peptidase_M15_3 | 0.79 |
| PF03118 | RNA_pol_A_CTD | 0.79 |
| PF00145 | DNA_methylase | 0.79 |
| PF05866 | RusA | 0.79 |
| PF00166 | Cpn10 | 0.79 |
| PF06067 | DUF932 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 3.17 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.79 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.79 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.56 % |
| Unclassified | root | N/A | 44.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002930|Water_101238 | All Organisms → cellular organisms → Bacteria | 4874 | Open in IMG/M |
| 3300002930|Water_102267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3353 | Open in IMG/M |
| 3300004448|Ga0065861_1005722 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300004461|Ga0066223_1020017 | Not Available | 622 | Open in IMG/M |
| 3300004804|Ga0007796_10179846 | Not Available | 626 | Open in IMG/M |
| 3300005580|Ga0049083_10137653 | Not Available | 840 | Open in IMG/M |
| 3300005585|Ga0049084_10225892 | Not Available | 634 | Open in IMG/M |
| 3300006037|Ga0075465_10037139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
| 3300006802|Ga0070749_10671932 | Not Available | 555 | Open in IMG/M |
| 3300006805|Ga0075464_10147667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1379 | Open in IMG/M |
| 3300006805|Ga0075464_10395308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
| 3300006805|Ga0075464_10474525 | Not Available | 764 | Open in IMG/M |
| 3300006805|Ga0075464_10534081 | Not Available | 719 | Open in IMG/M |
| 3300006917|Ga0075472_10652141 | Not Available | 528 | Open in IMG/M |
| 3300007344|Ga0070745_1188562 | Not Available | 766 | Open in IMG/M |
| 3300008119|Ga0114354_1058367 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
| 3300008267|Ga0114364_1000230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33490 | Open in IMG/M |
| 3300009068|Ga0114973_10260351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300009151|Ga0114962_10126414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
| 3300009151|Ga0114962_10359070 | Not Available | 797 | Open in IMG/M |
| 3300009151|Ga0114962_10464927 | Not Available | 674 | Open in IMG/M |
| 3300009151|Ga0114962_10506515 | Not Available | 637 | Open in IMG/M |
| 3300009151|Ga0114962_10594690 | Not Available | 575 | Open in IMG/M |
| 3300009152|Ga0114980_10052695 | Not Available | 2465 | Open in IMG/M |
| 3300009152|Ga0114980_10187667 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300009152|Ga0114980_10675649 | Not Available | 580 | Open in IMG/M |
| 3300009154|Ga0114963_10439326 | Not Available | 702 | Open in IMG/M |
| 3300009155|Ga0114968_10082956 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300009155|Ga0114968_10353213 | Not Available | 811 | Open in IMG/M |
| 3300009155|Ga0114968_10465042 | Not Available | 683 | Open in IMG/M |
| 3300009158|Ga0114977_10041741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2859 | Open in IMG/M |
| 3300009158|Ga0114977_10606580 | Not Available | 590 | Open in IMG/M |
| 3300009159|Ga0114978_10063463 | All Organisms → Viruses → Predicted Viral | 2505 | Open in IMG/M |
| 3300009159|Ga0114978_10465958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300009160|Ga0114981_10688701 | Not Available | 541 | Open in IMG/M |
| 3300009161|Ga0114966_10352715 | Not Available | 874 | Open in IMG/M |
| 3300009161|Ga0114966_10636962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300009163|Ga0114970_10042885 | All Organisms → Viruses → Predicted Viral | 2955 | Open in IMG/M |
| 3300009163|Ga0114970_10210301 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300009163|Ga0114970_10319846 | Not Available | 879 | Open in IMG/M |
| 3300009163|Ga0114970_10564761 | Not Available | 615 | Open in IMG/M |
| 3300009164|Ga0114975_10009466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6101 | Open in IMG/M |
| 3300009180|Ga0114979_10208345 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300009180|Ga0114979_10578227 | Not Available | 643 | Open in IMG/M |
| 3300009181|Ga0114969_10326668 | Not Available | 897 | Open in IMG/M |
| 3300009183|Ga0114974_10090907 | Not Available | 1978 | Open in IMG/M |
| 3300009183|Ga0114974_10144107 | All Organisms → Viruses → Predicted Viral | 1494 | Open in IMG/M |
| 3300009184|Ga0114976_10027438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3440 | Open in IMG/M |
| 3300009184|Ga0114976_10042432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2705 | Open in IMG/M |
| 3300009184|Ga0114976_10105180 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300009184|Ga0114976_10277013 | Not Available | 903 | Open in IMG/M |
| 3300009185|Ga0114971_10108940 | All Organisms → Viruses → Predicted Viral | 1690 | Open in IMG/M |
| 3300009185|Ga0114971_10161649 | All Organisms → Viruses → Predicted Viral | 1344 | Open in IMG/M |
| 3300009185|Ga0114971_10533327 | Not Available | 654 | Open in IMG/M |
| 3300010157|Ga0114964_10276900 | Not Available | 797 | Open in IMG/M |
| 3300010157|Ga0114964_10443664 | Not Available | 611 | Open in IMG/M |
| 3300010158|Ga0114960_10184197 | Not Available | 1100 | Open in IMG/M |
| 3300010160|Ga0114967_10196017 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300010160|Ga0114967_10283702 | Not Available | 856 | Open in IMG/M |
| 3300010160|Ga0114967_10294722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 835 | Open in IMG/M |
| 3300010334|Ga0136644_10817098 | Not Available | 501 | Open in IMG/M |
| 3300010885|Ga0133913_11675618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1600 | Open in IMG/M |
| 3300010885|Ga0133913_13076795 | Not Available | 1109 | Open in IMG/M |
| 3300011010|Ga0139557_1053584 | Not Available | 684 | Open in IMG/M |
| 3300011114|Ga0151515_10775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13356 | Open in IMG/M |
| 3300012665|Ga0157210_1000309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22657 | Open in IMG/M |
| 3300013004|Ga0164293_10184795 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
| 3300013285|Ga0136642_1100505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300013286|Ga0136641_1012157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2818 | Open in IMG/M |
| 3300013372|Ga0177922_10472717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage Va1 | 1796 | Open in IMG/M |
| 3300015050|Ga0181338_1001555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4132 | Open in IMG/M |
| 3300015050|Ga0181338_1026772 | Not Available | 887 | Open in IMG/M |
| 3300015050|Ga0181338_1031235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300017716|Ga0181350_1069235 | Not Available | 909 | Open in IMG/M |
| 3300017716|Ga0181350_1169815 | Not Available | 502 | Open in IMG/M |
| 3300017754|Ga0181344_1027921 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300017766|Ga0181343_1087229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
| 3300017766|Ga0181343_1098748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 830 | Open in IMG/M |
| 3300017766|Ga0181343_1148184 | Not Available | 655 | Open in IMG/M |
| 3300017777|Ga0181357_1240864 | Not Available | 631 | Open in IMG/M |
| 3300017784|Ga0181348_1162490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300019784|Ga0181359_1012906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3032 | Open in IMG/M |
| 3300020158|Ga0194038_1039459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1491 | Open in IMG/M |
| 3300020172|Ga0211729_11126582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2783 | Open in IMG/M |
| 3300020205|Ga0211731_11556079 | Not Available | 634 | Open in IMG/M |
| 3300021075|Ga0194063_10081255 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300021438|Ga0213920_1014207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2170 | Open in IMG/M |
| 3300021519|Ga0194048_10339499 | Not Available | 536 | Open in IMG/M |
| 3300021961|Ga0222714_10019454 | Not Available | 5362 | Open in IMG/M |
| 3300021963|Ga0222712_10269751 | Not Available | 1080 | Open in IMG/M |
| 3300022190|Ga0181354_1250456 | Not Available | 505 | Open in IMG/M |
| 3300022752|Ga0214917_10180317 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300025896|Ga0208916_10023676 | All Organisms → Viruses → Predicted Viral | 2440 | Open in IMG/M |
| 3300025896|Ga0208916_10069829 | Not Available | 1460 | Open in IMG/M |
| 3300027733|Ga0209297_1017427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3445 | Open in IMG/M |
| 3300027734|Ga0209087_1064130 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
| 3300027736|Ga0209190_1001014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20013 | Open in IMG/M |
| 3300027736|Ga0209190_1075023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
| 3300027746|Ga0209597_1171986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300027749|Ga0209084_1007870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6806 | Open in IMG/M |
| 3300027749|Ga0209084_1105480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
| 3300027754|Ga0209596_1026294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3372 | Open in IMG/M |
| 3300027754|Ga0209596_1074705 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
| 3300027754|Ga0209596_1120970 | Not Available | 1204 | Open in IMG/M |
| 3300027759|Ga0209296_1011030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5424 | Open in IMG/M |
| 3300027770|Ga0209086_10251319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300027782|Ga0209500_10036443 | Not Available | 2728 | Open in IMG/M |
| 3300027902|Ga0209048_10153891 | Not Available | 1712 | Open in IMG/M |
| 3300027963|Ga0209400_1051755 | Not Available | 2122 | Open in IMG/M |
| 3300027963|Ga0209400_1111361 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300027963|Ga0209400_1201798 | Not Available | 823 | Open in IMG/M |
| 3300027969|Ga0209191_1084315 | Not Available | 1381 | Open in IMG/M |
| 3300027971|Ga0209401_1050581 | All Organisms → Viruses → Predicted Viral | 1886 | Open in IMG/M |
| 3300027973|Ga0209298_10019022 | Not Available | 3469 | Open in IMG/M |
| 3300027974|Ga0209299_1029595 | All Organisms → Viruses → Predicted Viral | 2387 | Open in IMG/M |
| 3300028392|Ga0304729_1140653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 786 | Open in IMG/M |
| 3300028393|Ga0304728_1209542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300031746|Ga0315293_10392463 | Not Available | 1094 | Open in IMG/M |
| 3300031772|Ga0315288_10246426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1904 | Open in IMG/M |
| 3300031772|Ga0315288_11092919 | Not Available | 699 | Open in IMG/M |
| 3300031772|Ga0315288_11202813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300032046|Ga0315289_10392820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1384 | Open in IMG/M |
| 3300032516|Ga0315273_10939393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300033996|Ga0334979_0198807 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300034092|Ga0335010_0597906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 54.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.32% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.76% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.17% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.38% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.59% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.59% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 1.59% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.79% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021075 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Water_1012385 | 3300002930 | Estuary Water | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLITGN* |
| Water_1022676 | 3300002930 | Estuary Water | MKLDKYTQHGIDGPYTSSPTLADKVLFWLTGFVAGFVLAILMLGK* |
| Ga0065861_10057223 | 3300004448 | Marine | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLILGN* |
| Ga0066223_10200172 | 3300004461 | Marine | MKHSNYTQHTIEGPYQPSIPTLADKVLFWLSGFVAGFILALLMIGK* |
| Ga0007796_101798461 | 3300004804 | Freshwater | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLITG |
| Ga0049083_101376532 | 3300005580 | Freshwater Lentic | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVCGLIFAFLITGN* |
| Ga0049084_102258921 | 3300005585 | Freshwater Lentic | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIF |
| Ga0075465_100371391 | 3300006037 | Aqueous | MKANTMKHSKYTEHGLDGPYTPAPTLVDKVLFWLSGFVCGLIFAL |
| Ga0070749_106719322 | 3300006802 | Aqueous | TTRLPVMKANTMKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVCGLIFALLITGN* |
| Ga0075464_101476671 | 3300006805 | Aqueous | KHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN* |
| Ga0075464_103953083 | 3300006805 | Aqueous | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN* |
| Ga0075464_104745252 | 3300006805 | Aqueous | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIFALLITGN* |
| Ga0075464_105340812 | 3300006805 | Aqueous | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGFIFALLITGN* |
| Ga0075472_106521412 | 3300006917 | Aqueous | TMKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVCGLIFALLITGN* |
| Ga0070745_11885621 | 3300007344 | Aqueous | MKHSKYTEHGLDGPYLAPPTLVDKVLFWLSGFVCGLIFA |
| Ga0114354_10583673 | 3300008119 | Freshwater, Plankton | MKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVAGLVFTLLITGN* |
| Ga0114364_100023029 | 3300008267 | Freshwater, Plankton | MKHSNYTKHGIEGPFSPPPTLVDKVLFWLSGFVAGLIFTLLITGN* |
| Ga0114973_102603512 | 3300009068 | Freshwater Lake | MKHSKYTEHGIEGPFSPPPTLADKVLFWLSGFVCGLVFTLLITGN* |
| Ga0114973_105056051 | 3300009068 | Freshwater Lake | HAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLITGN* |
| Ga0114962_101264143 | 3300009151 | Freshwater Lake | MKLSKYTEHGIEGPFLSTPSFADKVIFWLSGFVAGLIFTLLITGN* |
| Ga0114962_103590701 | 3300009151 | Freshwater Lake | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVSG |
| Ga0114962_104649271 | 3300009151 | Freshwater Lake | GLDGPYTPAPTLVDKVLFWLSGFVCGLIFALLITGN* |
| Ga0114962_105065151 | 3300009151 | Freshwater Lake | QHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLITGN* |
| Ga0114962_105946902 | 3300009151 | Freshwater Lake | MKHRNYTQHTIEGPYQPSIPTLADKVLFWLSGFVAGFILALLTIGK* |
| Ga0114980_100526954 | 3300009152 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALFITGN* |
| Ga0114980_101876671 | 3300009152 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVCGLIFALFITGN* |
| Ga0114980_106756492 | 3300009152 | Freshwater Lake | MKLDKYTQHTLEGPYQPSIPTLADKVLFWLSGFVAGFVLSLLIWN* |
| Ga0114963_104393263 | 3300009154 | Freshwater Lake | MKHSNYTEHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN* |
| Ga0114968_100829562 | 3300009155 | Freshwater Lake | MKHSNYTEHGIDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN* |
| Ga0114968_103532133 | 3300009155 | Freshwater Lake | MKLDKYTEHGIEGPFTSPPTLVDKVLFWLSGFVSGLIFA |
| Ga0114968_104650421 | 3300009155 | Freshwater Lake | MKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVSGLIFALLITGN* |
| Ga0114977_100417412 | 3300009158 | Freshwater Lake | MKHSKYAEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIFALLITGN* |
| Ga0114977_106065801 | 3300009158 | Freshwater Lake | TGTLMKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVAGLVFTLLITGN* |
| Ga0114978_100634633 | 3300009159 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFISGLIFALLITGN* |
| Ga0114978_104659581 | 3300009159 | Freshwater Lake | MKHSKYTEHGIEGPFTPPPTLVDKVLFWLSGFVTGLVFT |
| Ga0114981_106887011 | 3300009160 | Freshwater Lake | KYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLITGN* |
| Ga0114966_103527151 | 3300009161 | Freshwater Lake | MKLSKYTEHGIDGPYTPAPTLVDKVLFWLSGFVCGLIFA |
| Ga0114966_106369621 | 3300009161 | Freshwater Lake | MKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVSGLIFAL |
| Ga0114970_100428855 | 3300009163 | Freshwater Lake | MKHSKYTEHGLDGPYTPAPTLVDKVLFWLSGFVCGLIFAFLITGN* |
| Ga0114970_102103012 | 3300009163 | Freshwater Lake | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVCGLIFALLITGN* |
| Ga0114970_103198461 | 3300009163 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLI |
| Ga0114970_105647613 | 3300009163 | Freshwater Lake | MKLDKYTEHGIEGPFTSPPTLVDKVLFWLSGFVSGLI |
| Ga0114975_100094662 | 3300009164 | Freshwater Lake | MKLDKYTQHTLEGPYQPSIPTLADKVLFWLSGFVAGFILALLTFGK* |
| Ga0114979_102083453 | 3300009180 | Freshwater Lake | MKLDKYTEHGIEGPFTPPPTLADKVLFWLSGFVAGFILALLTFGK* |
| Ga0114979_105782271 | 3300009180 | Freshwater Lake | SKYAEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIFALLITGN* |
| Ga0114969_103266681 | 3300009181 | Freshwater Lake | YTEHGIDGPYTPAPTLVDKVLFWLSGFVCGLIFALLITGN* |
| Ga0114974_100909073 | 3300009183 | Freshwater Lake | MKLDKYTEHGIEGPFTPPPTLADKVLFWLSGFVCGLVFTLLITGN* |
| Ga0114974_101441072 | 3300009183 | Freshwater Lake | MKHSKYIQHAIQGPFTSNKPTLVDQTIFWLSGFVSGLIFALLITGN* |
| Ga0114976_100274388 | 3300009184 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLVDKVLFWLSGFVSGLIFALFITGN* |
| Ga0114976_100424327 | 3300009184 | Freshwater Lake | MKHSKYAEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIFALFITGN* |
| Ga0114976_101051801 | 3300009184 | Freshwater Lake | KVKTMKLDKYTQHTLEGPYQPSIPTLADKVLFWLSGFVAGFILALLTFGK* |
| Ga0114976_102770132 | 3300009184 | Freshwater Lake | MKHSNYTQHTIEGPYQPSIPTLADKVLFWLSGFVAGFILALLTIGK* |
| Ga0114971_101089401 | 3300009185 | Freshwater Lake | SNQHLQTFDIGTYMKHSNYTEHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFAFLITGN* |
| Ga0114971_101616495 | 3300009185 | Freshwater Lake | MKLSKYTEHGIDGPYTPAPTLVDKVLFWLSGFVCGLIFALLITGN* |
| Ga0114971_105333273 | 3300009185 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLVDKVLFWLSGFVSGLIFAL |
| Ga0114964_102769001 | 3300010157 | Freshwater Lake | KAKTMKHRNYTQHTIEGPYQPSIPTLADKVLFWLSGFVAGFILALLTIGK* |
| Ga0114964_104436643 | 3300010157 | Freshwater Lake | MKHSNYTQHTLEGPYLPSIPTLADKVIFWLSGFVAGFILALLTIGK* |
| Ga0114960_101841974 | 3300010158 | Freshwater Lake | TLMKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVTGLVFTLLITGN* |
| Ga0114967_101960171 | 3300010160 | Freshwater Lake | MKHSNYTEHGIDGPYTPAPTLVDKVLFWLSGFVCGLIFA |
| Ga0114967_102837022 | 3300010160 | Freshwater Lake | MKLDKYTEHGIEGPFTSPPTLVDKVLFWLSGFVSGLIFALLITGN* |
| Ga0114967_102947221 | 3300010160 | Freshwater Lake | QHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN* |
| Ga0136644_108170981 | 3300010334 | Freshwater Lake | MKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVAGLVFTL |
| Ga0133913_116756181 | 3300010885 | Freshwater Lake | MKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVAGLVFTLL |
| Ga0133913_130767951 | 3300010885 | Freshwater Lake | MKLNKYTEHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLI |
| Ga0139557_10535843 | 3300011010 | Freshwater | KHSKYTEHGIEGPFTPPPTLVDKVLFWLSGFVAGLVFTLLITGN* |
| Ga0151515_1077512 | 3300011114 | Freshwater | MKLNKYTEHAIQGPFTSDKPTLVDQTLFWLSGFVSGLIFALLITGN* |
| Ga0157210_10003099 | 3300012665 | Freshwater | MKLDKYTQHSIDGPYSAKPSLVDKVLFWLSGFVAGLIFTLLITGN* |
| Ga0164293_101847954 | 3300013004 | Freshwater | MKHDKYTEHGIEGPFSPPPTLVDKVLFWLSGFVAGLVFTLLITGN* |
| Ga0136642_11005053 | 3300013285 | Freshwater | MKHSKYTEHGLDGPYFAPPMLADKVIFWLSGFVAGFVLSLLIWS* |
| Ga0136641_10121574 | 3300013286 | Freshwater | MKHSNYTQHTLEGPYLPTTPTLANKVIFWLSGFVAGFVLSLLIWS* |
| Ga0177922_104727172 | 3300013372 | Freshwater | MKHDKYTQHTLEGPYQPSIPTLADKVLFWLSGFVAGFILALLTIGK* |
| Ga0181338_10015553 | 3300015050 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLADKVIFWLSGFVSGLIFALLITGN* |
| Ga0181338_10267723 | 3300015050 | Freshwater Lake | HSKYTEHGLDGPYTPAPTLVDKVIFWLSGFVCGLIFALLITGN* |
| Ga0181338_10312352 | 3300015050 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLTGFVSGLIFALLITGN* |
| Ga0181350_10692352 | 3300017716 | Freshwater Lake | MKHDKYTQNTLEGPYQPSIPTLADKVLFWLSGFVAGFILALLTFGK |
| Ga0181350_11698152 | 3300017716 | Freshwater Lake | MKHYKYTEHGLDGPYLAPPTLVDKVIFWLSGFVCGLIFALFITGN |
| Ga0181344_10279211 | 3300017754 | Freshwater Lake | MKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVAG |
| Ga0181343_10872291 | 3300017766 | Freshwater Lake | HSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLITGN |
| Ga0181343_10987481 | 3300017766 | Freshwater Lake | VMKANTMKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVAGLVFTLLITGN |
| Ga0181343_11481841 | 3300017766 | Freshwater Lake | YIQHAIQGPFTSDKPTLVDQTLFWLSGFVSGLIFALLITGN |
| Ga0181357_12408641 | 3300017777 | Freshwater Lake | MKHSKYTEHGLDGPYTPAPTLVDKVLFWLSGFVSGL |
| Ga0181348_11624902 | 3300017784 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLTGFVSGLIFALLITGN |
| Ga0181359_10129062 | 3300019784 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLADKVIFWLSGFVSGLIFALLITGN |
| Ga0194038_10394592 | 3300020158 | Anoxic Zone Freshwater | MKHDKYTEHGIEGPFTPPPTLVDKVLFWLSGFVTGLVFTLLITGN |
| Ga0211729_111265826 | 3300020172 | Freshwater | MKLDKYTQHGIDGPYTSSPTLADKVLFWLTGFVAGFVLAILMLGK |
| Ga0211731_115560791 | 3300020205 | Freshwater | MKHSKYTEHGIEGPFSPPPTLVDKVLFWLSGFVAGLVFTLLITGN |
| Ga0194063_100812553 | 3300021075 | Anoxic Zone Freshwater | MKHSNYTEHGIEGPFTPPPTLVDKVLFWLSGFVTGLVFTLLITGN |
| Ga0213920_10142072 | 3300021438 | Freshwater | MKHDKYTQNGIEGPFTPPPTLADKVLFWLSGFVAGLVFTLLITGN |
| Ga0194048_103394991 | 3300021519 | Anoxic Zone Freshwater | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALF |
| Ga0222714_1001945411 | 3300021961 | Estuarine Water | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVCGLIFALLITGN |
| Ga0222712_102697512 | 3300021963 | Estuarine Water | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLITGN |
| Ga0181354_12504561 | 3300022190 | Freshwater Lake | LKTMKHYKYTEHGLDGPYLAPPTLVDKVIFWLSGFVCGLIFALFITGN |
| Ga0214917_101803174 | 3300022752 | Freshwater | MKHSNYTEHGLDGPYLAPPTLVDKVIFWLSGFVCGLIFALLITGN |
| Ga0208916_100236763 | 3300025896 | Aqueous | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN |
| Ga0208916_100698291 | 3300025896 | Aqueous | SKYIQHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN |
| Ga0209297_10174277 | 3300027733 | Freshwater Lake | MKHSKYAEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIFALLITGN |
| Ga0209087_10641302 | 3300027734 | Freshwater Lake | MKHSNYTQHTIEGPYQPSIPTLADKVLFWLSGFVAGFILALLTFGK |
| Ga0209190_100101419 | 3300027736 | Freshwater Lake | MKHSKYTEHGLDGPYTPAPTLVDKVLFWLSGFVCGLIFAFLITGN |
| Ga0209190_10750235 | 3300027736 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIFALLITGN |
| Ga0209597_11719861 | 3300027746 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLVDKVLFWLSGFVCGLIFALL |
| Ga0209084_100787017 | 3300027749 | Freshwater Lake | MKHRNYTQHTIEGPYQPSIPTLADKVLFWLSGFVAGFILALLTIGK |
| Ga0209084_11054802 | 3300027749 | Freshwater Lake | MKLSKYTEHGIEGPFLSTPSFADKVIFWLSGFVAGLIFTLLITGN |
| Ga0209596_10262948 | 3300027754 | Freshwater Lake | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVSGLIFALFITGN |
| Ga0209596_10747053 | 3300027754 | Freshwater Lake | MKLDKYTEHGIEGPFTSPPTLVDKVLFWLSGFVSGLIFALLITGN |
| Ga0209596_11209702 | 3300027754 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALLILGN |
| Ga0209296_101103012 | 3300027759 | Freshwater Lake | MKHSKYIQHAIQGPFTSNKPTLVDQTIFWLSGFVSGLIFALLITGN |
| Ga0209086_102513192 | 3300027770 | Freshwater Lake | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVSGLIFALLILGN |
| Ga0209500_100364433 | 3300027782 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFISGLIFALLITGN |
| Ga0209048_101538914 | 3300027902 | Freshwater Lake Sediment | MKLDKYTEHGIEGPFTPPPSLADKVLFWLSGFVAGLVFTLLITGN |
| Ga0209400_10517555 | 3300027963 | Freshwater Lake | MKLDKYTQHTLEGPYQPSIPTLADKVLFWLSGFVAGFVLSLLIWN |
| Ga0209400_11113612 | 3300027963 | Freshwater Lake | MKHSNYTEHGIDGPYTPAPTLVDKVLFWLSGFVSGLIFALLITGN |
| Ga0209400_12017984 | 3300027963 | Freshwater Lake | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVSGLI |
| Ga0209191_10843151 | 3300027969 | Freshwater Lake | MKLDKYTQHTLEGPYQPSIPTLADKVLFWLSGFVAGFILALLTFGK |
| Ga0209401_10505812 | 3300027971 | Freshwater Lake | MKLSKYTEHGIDGPYTPAPTLVDKVLFWLSGFVCGLIFALLITGN |
| Ga0209298_100190226 | 3300027973 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVSGLIFALFITGN |
| Ga0209299_10295953 | 3300027974 | Freshwater Lake | MKHSKYIQHAIQGPFTSDKPTLVDQTIFWLSGFVCGLIFALFITGN |
| Ga0304729_11406533 | 3300028392 | Freshwater Lake | EHGLDGPYTPAPTLVDKVLFWLSGFVCGLIFALLISGN |
| Ga0304728_12095423 | 3300028393 | Freshwater Lake | KGISMKLSKYTEHGIEGPFLSTPSFADKVIFWLSGFVAGLIFTLLITGN |
| Ga0315293_103924633 | 3300031746 | Sediment | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVCGLIFALLITGN |
| Ga0315288_102464262 | 3300031772 | Sediment | MKHSKYIQHGLDGPYLAPPTLVDKVLFWLSGFVSGLIFALLITGN |
| Ga0315288_110929192 | 3300031772 | Sediment | TRLNTMKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVCGLIFALLITGN |
| Ga0315288_112028131 | 3300031772 | Sediment | MKHSKYTEHGLDGPYLAPPTLVDKVIFWLSGFVCGLIFALL |
| Ga0315289_103928204 | 3300032046 | Sediment | MKHSKYTEHGLDGPYLAPPTLVDKVLFWLSGFVSGLIFALLITGN |
| Ga0315273_109393933 | 3300032516 | Sediment | LKHSKYTEHGLDGPYLAPPTLVDKVLFWLSGFVSGLIFALLITGN |
| Ga0334979_0198807_927_1079 | 3300033996 | Freshwater | MKANTMKHDKYTEHGIEGPFSPPPTLVDKVLFWLSGFVAGLVFTLLITGN |
| Ga0335010_0597906_446_559 | 3300034092 | Freshwater | MKHSKYIQHGLDGPYTPAPTLVDKVLFWLSGFVCGLIF |
| ⦗Top⦘ |