| Basic Information | |
|---|---|
| Taxon OID | 3300010152 Open in IMG/M |
| Scaffold ID | Ga0126318_11037783 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 812 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Great Plains ARM Site, Oklahoma | |||||||
| Coordinates | Lat. (o) | 36.605 | Long. (o) | -97.485 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018722 | Metagenome / Metatranscriptome | 233 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126318_110377831 | F018722 | GAGG | VIYAFTVAVSRLKGPTAPAAVDLSPVARDYPNRAFVGFFIPPR |
| ⦗Top⦘ |