Scaffold Ga0126320_1094572

Overview

Basic Information

• Taxon OID: 3300010146
• Scaffold ID: Ga0126320_1094572
• Source Dataset Name: Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 563
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location

• Location Name: Jasper ridge, California
• Coordinates
  • Lat. (^o): 37.406
  • Long. (^o): -122.2269
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041718	Metagenome / Metatranscriptome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126320_10945721	F041718	GAGG	VTKLVWRVKLVTELQAEEPTEVELTCFERDEQVGLADLGLSLAEAKQLTATQAG