Scaffold Ga0126367_11765

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126367_11765

Scaffold Ga0126367_11765

Overview

Basic Information
Taxon OID	3300010059 Open in IMG/M
Scaffold ID	Ga0126367_11765 Open in IMG/M
Source Dataset Name	Continental margin sediment microbial communities from the Arctic Ocean - SV_M10_0 metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	518
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	Arctic Ocean
Coordinates	Lat. (^o)	79.0077	Long. (^o)	6.9046	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077370	Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126367_117651	F077370	N/A	INRPANRKRILKNNSQQLAVPKPMSILGETIDRAIDILIDIYAVNSIGTPFYSFSSSTGSPNMSANITDLMILQFTEYSEITRIYGLVKLKKIQLAFTRASNFIGGGSSTIQNTPSLFLQASTIPYTAGSTTLQRAVAQSDNAAEIDLQTFEPKAFNILLPPHVVSNNRASN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.