NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010059

3300010059: Continental margin sediment microbial communities from the Arctic Ocean - SV_M10_0 metaT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300010059 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120351 | Gp0146718 | Ga0126367
Sample NameContinental margin sediment microbial communities from the Arctic Ocean - SV_M10_0 metaT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1959503
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameContinental Margin Sediment Microbial Communities From Various Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecontinental marginmarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationArctic Ocean
CoordinatesLat. (o)79.0077Long. (o)6.9046Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003497Metagenome / Metatranscriptome483Y
F077370Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0126367_11752Not Available559Open in IMG/M
Ga0126367_11765Not Available518Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0126367_11752Ga0126367_117521F003497NSPLPDRHARSKHGSQRIGDAALLLPVTAFIRLRISAPEPIRHFYLLEAFVSERPFARPQRLFSFENHRGEVKAPDLSLRRNSELFFQPVRPSAPTLGGVRHALGDVRRTKPVAVSRAQNSQTSIQPSLPFRTFVPPDRSAQSAAWSEKLTLVPGPFFLRSPKASITF*
Ga0126367_11765Ga0126367_117651F077370INRPANRKRILKNNSQQLAVPKPMSILGETIDRAIDILIDIYAVNSIGTPFYSFSSSTGSPNMSANITDLMILQFTEYSEITRIYGLVKLKKIQLAFTRASNFIGGGSSTIQNTPSLFLQASTIPYTAGSTTLQRAVAQSDNAAEIDLQTFEPKAFNILLPPHVVSNNRASN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.