NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126367_11752

Scaffold Ga0126367_11752


Overview

Basic Information
Taxon OID3300010059 Open in IMG/M
Scaffold IDGa0126367_11752 Open in IMG/M
Source Dataset NameContinental margin sediment microbial communities from the Arctic Ocean - SV_M10_0 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)559
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment → Continental Margin Sediment Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameArctic Ocean
CoordinatesLat. (o)79.0077Long. (o)6.9046Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003497Metagenome / Metatranscriptome483Y

Sequences

Protein IDFamilyRBSSequence
Ga0126367_117521F003497N/ANSPLPDRHARSKHGSQRIGDAALLLPVTAFIRLRISAPEPIRHFYLLEAFVSERPFARPQRLFSFENHRGEVKAPDLSLRRNSELFFQPVRPSAPTLGGVRHALGDVRRTKPVAVSRAQNSQTSIQPSLPFRTFVPPDRSAQSAAWSEKLTLVPGPFFLRSPKASITF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.