| Basic Information | |
|---|---|
| Taxon OID | 3300010052 Open in IMG/M |
| Scaffold ID | Ga0133944_1000293 Open in IMG/M |
| Source Dataset Name | Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 188692 |
| Total Scaffold Genes | 189 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 144 (76.19%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid → Microbial Community Associated With The Xenic Strain Of Eucapsis Sp. Utex 1519 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UTEX collection | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020707 | Metagenome / Metatranscriptome | 222 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0133944_100029319 | F020707 | AGCAGG | MCLIHGDFKHFAASKANHFRLQGKNSSIMYAKLLSIMRAETGLVTSG* |
| ⦗Top⦘ |