Basic Information | |
---|---|
Family ID | F020707 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 222 |
Average Sequence Length | 47 residues |
Representative Sequence | MCLIHGDFKHFAASKANHFRHHRKDSSIMRAKVLSIMRAEAAPVTSG |
Number of Associated Samples | 201 |
Number of Associated Scaffolds | 222 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 26.51 % |
% of genes near scaffold ends (potentially truncated) | 32.43 % |
% of genes from short scaffolds (< 2000 bps) | 88.74 % |
Associated GOLD sequencing projects | 180 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.541 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.063 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.036 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.297 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.00% β-sheet: 0.00% Coil/Unstructured: 56.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 222 Family Scaffolds |
---|---|---|
PF01523 | PmbA_TldD | 43.24 |
PF01040 | UbiA | 3.60 |
PF04028 | DUF374 | 0.90 |
PF02530 | Porin_2 | 0.90 |
PF04452 | Methyltrans_RNA | 0.90 |
PF00459 | Inositol_P | 0.90 |
PF12838 | Fer4_7 | 0.45 |
PF00440 | TetR_N | 0.45 |
PF01634 | HisG | 0.45 |
PF04413 | Glycos_transf_N | 0.45 |
PF00034 | Cytochrom_C | 0.45 |
PF12802 | MarR_2 | 0.45 |
PF02371 | Transposase_20 | 0.45 |
PF13773 | DUF4170 | 0.45 |
PF13561 | adh_short_C2 | 0.45 |
PF04392 | ABC_sub_bind | 0.45 |
PF02771 | Acyl-CoA_dh_N | 0.45 |
PF00550 | PP-binding | 0.45 |
COG ID | Name | Functional Category | % Frequency in 222 Family Scaffolds |
---|---|---|---|
COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 43.24 |
COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 0.90 |
COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 0.90 |
COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.45 |
COG1519 | 3-deoxy-D-manno-octulosonic-acid transferase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.45 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.45 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.54 % |
Unclassified | root | N/A | 9.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459009|GA8DASG01DYONK | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 533 | Open in IMG/M |
3300000956|JGI10216J12902_108494750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1075 | Open in IMG/M |
3300001661|JGI12053J15887_10015426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 4241 | Open in IMG/M |
3300002184|JGI24770J26754_10025263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 3033 | Open in IMG/M |
3300002568|C688J35102_120615109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1246 | Open in IMG/M |
3300003215|JGI25153J46596_10005736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 6471 | Open in IMG/M |
3300003215|JGI25153J46596_10055643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1106 | Open in IMG/M |
3300003322|rootL2_10136017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1786 | Open in IMG/M |
3300004643|Ga0062591_100973971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 804 | Open in IMG/M |
3300004782|Ga0062382_10182075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 908 | Open in IMG/M |
3300005184|Ga0066671_10028174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2598 | Open in IMG/M |
3300005328|Ga0070676_10383465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 974 | Open in IMG/M |
3300005333|Ga0070677_10395743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 727 | Open in IMG/M |
3300005336|Ga0070680_100630504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 921 | Open in IMG/M |
3300005347|Ga0070668_101368038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 645 | Open in IMG/M |
3300005355|Ga0070671_100400816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1173 | Open in IMG/M |
3300005356|Ga0070674_101165915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 683 | Open in IMG/M |
3300005364|Ga0070673_101865323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 570 | Open in IMG/M |
3300005438|Ga0070701_10652345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 703 | Open in IMG/M |
3300005447|Ga0066689_10674727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 648 | Open in IMG/M |
3300005456|Ga0070678_101332374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 669 | Open in IMG/M |
3300005459|Ga0068867_101618337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 606 | Open in IMG/M |
3300005471|Ga0070698_101136775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 730 | Open in IMG/M |
3300005511|Ga0077121_10480300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 840 | Open in IMG/M |
3300005539|Ga0068853_100350210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1374 | Open in IMG/M |
3300005543|Ga0070672_101672104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 572 | Open in IMG/M |
3300005555|Ga0066692_10228196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1172 | Open in IMG/M |
3300005559|Ga0066700_10313532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1107 | Open in IMG/M |
3300005577|Ga0068857_100443069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1213 | Open in IMG/M |
3300005591|Ga0070761_10732701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 620 | Open in IMG/M |
3300005617|Ga0068859_103024115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300005618|Ga0068864_102507703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 522 | Open in IMG/M |
3300005843|Ga0068860_101820781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
3300005844|Ga0068862_100598001 | Not Available | 1059 | Open in IMG/M |
3300005983|Ga0081540_1333799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
3300005985|Ga0081539_10150447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1120 | Open in IMG/M |
3300005992|Ga0073924_1050973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
3300006041|Ga0075023_100196862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 775 | Open in IMG/M |
3300006042|Ga0075368_10159816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 944 | Open in IMG/M |
3300006048|Ga0075363_100690501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
3300006353|Ga0075370_10635442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 648 | Open in IMG/M |
3300006354|Ga0075021_10132271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1500 | Open in IMG/M |
3300006417|Ga0069787_10535631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas endophytica | 571 | Open in IMG/M |
3300006800|Ga0066660_11292422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
3300006804|Ga0079221_11425240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 552 | Open in IMG/M |
3300006854|Ga0075425_100855734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1040 | Open in IMG/M |
3300006953|Ga0074063_10060634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1511 | Open in IMG/M |
3300007788|Ga0099795_10166105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 914 | Open in IMG/M |
3300007788|Ga0099795_10421809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 610 | Open in IMG/M |
3300007788|Ga0099795_10514120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 560 | Open in IMG/M |
3300007788|Ga0099795_10525556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 554 | Open in IMG/M |
3300009094|Ga0111539_12241954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
3300009100|Ga0075418_12633146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 549 | Open in IMG/M |
3300009137|Ga0066709_104524450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas endophytica | 508 | Open in IMG/M |
3300009148|Ga0105243_10773909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 943 | Open in IMG/M |
3300009162|Ga0075423_12083151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 615 | Open in IMG/M |
3300009174|Ga0105241_12417416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
3300009175|Ga0073936_10256665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1174 | Open in IMG/M |
3300009177|Ga0105248_10323078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1738 | Open in IMG/M |
3300009351|Ga0115924_1001669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 604 | Open in IMG/M |
3300009551|Ga0105238_11385408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 730 | Open in IMG/M |
3300009551|Ga0105238_11452248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 714 | Open in IMG/M |
3300009553|Ga0105249_11821355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas endophytica | 681 | Open in IMG/M |
3300009683|Ga0116224_10434596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 625 | Open in IMG/M |
3300010038|Ga0126315_10569392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 729 | Open in IMG/M |
3300010042|Ga0126314_10250992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1255 | Open in IMG/M |
3300010047|Ga0126382_11915929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
3300010052|Ga0133944_1000293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 188692 | Open in IMG/M |
3300010159|Ga0099796_10140208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 944 | Open in IMG/M |
3300010159|Ga0099796_10501533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas endophytica | 543 | Open in IMG/M |
3300010166|Ga0126306_11037207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
3300010303|Ga0134082_10334833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 639 | Open in IMG/M |
3300010358|Ga0126370_11723198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 604 | Open in IMG/M |
3300010359|Ga0126376_11335189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 739 | Open in IMG/M |
3300010362|Ga0126377_13536525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 505 | Open in IMG/M |
3300010396|Ga0134126_11575003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 723 | Open in IMG/M |
3300010399|Ga0134127_10918555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 931 | Open in IMG/M |
3300010400|Ga0134122_11166254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 768 | Open in IMG/M |
3300010401|Ga0134121_11689329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 656 | Open in IMG/M |
3300011270|Ga0137391_11574703 | Not Available | 501 | Open in IMG/M |
3300012177|Ga0153943_1101094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
3300012205|Ga0137362_10787254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
3300012469|Ga0150984_111817435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 578 | Open in IMG/M |
3300012475|Ga0157317_1012799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
3300012486|Ga0157331_1014443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
3300012896|Ga0157303_10196358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 579 | Open in IMG/M |
3300012909|Ga0157290_10391019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
3300012922|Ga0137394_10202216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1697 | Open in IMG/M |
3300012923|Ga0137359_10798300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 818 | Open in IMG/M |
3300012924|Ga0137413_10020943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3438 | Open in IMG/M |
3300012925|Ga0137419_11290775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 613 | Open in IMG/M |
3300012927|Ga0137416_10019750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4277 | Open in IMG/M |
3300012929|Ga0137404_11394748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 647 | Open in IMG/M |
3300012938|Ga0162651_100086142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
3300012944|Ga0137410_11029317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 702 | Open in IMG/M |
3300012944|Ga0137410_11063348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 691 | Open in IMG/M |
3300012955|Ga0164298_10073672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1727 | Open in IMG/M |
3300012958|Ga0164299_10055179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1879 | Open in IMG/M |
3300012960|Ga0164301_10163920 | Not Available | 1376 | Open in IMG/M |
3300012972|Ga0134077_10133155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 982 | Open in IMG/M |
3300012985|Ga0164308_10374215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 1157 | Open in IMG/M |
3300012987|Ga0164307_11915524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
3300013297|Ga0157378_12955736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 527 | Open in IMG/M |
3300013307|Ga0157372_13065612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 534 | Open in IMG/M |
3300014325|Ga0163163_11938913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 649 | Open in IMG/M |
3300014968|Ga0157379_10628971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 1004 | Open in IMG/M |
3300015200|Ga0173480_10184308 | Not Available | 1093 | Open in IMG/M |
3300015202|Ga0167663_1038589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1789 | Open in IMG/M |
3300015241|Ga0137418_10203674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1708 | Open in IMG/M |
3300015242|Ga0137412_10027282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4661 | Open in IMG/M |
3300015242|Ga0137412_10823019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 679 | Open in IMG/M |
3300015264|Ga0137403_11529671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 519 | Open in IMG/M |
3300015371|Ga0132258_13882374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1017 | Open in IMG/M |
3300017965|Ga0190266_10565434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 679 | Open in IMG/M |
3300018051|Ga0184620_10060147 | Not Available | 1093 | Open in IMG/M |
3300018061|Ga0184619_10473387 | Not Available | 556 | Open in IMG/M |
3300018067|Ga0184611_1168924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 777 | Open in IMG/M |
3300018075|Ga0184632_10355474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 625 | Open in IMG/M |
3300018076|Ga0184609_10169485 | Not Available | 1010 | Open in IMG/M |
3300018431|Ga0066655_11132591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
3300018466|Ga0190268_11417177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 597 | Open in IMG/M |
3300018476|Ga0190274_10762632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1020 | Open in IMG/M |
3300018476|Ga0190274_10972536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 921 | Open in IMG/M |
3300018481|Ga0190271_12430422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 627 | Open in IMG/M |
3300018482|Ga0066669_11229763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 676 | Open in IMG/M |
3300019362|Ga0173479_10238459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 792 | Open in IMG/M |
3300019362|Ga0173479_10512604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 608 | Open in IMG/M |
3300019377|Ga0190264_10183108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1130 | Open in IMG/M |
3300019377|Ga0190264_11653084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 567 | Open in IMG/M |
3300019889|Ga0193743_1045168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1958 | Open in IMG/M |
3300020140|Ga0179590_1089005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 826 | Open in IMG/M |
3300020199|Ga0179592_10487726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 529 | Open in IMG/M |
3300021086|Ga0179596_10421050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 675 | Open in IMG/M |
3300021510|Ga0222621_1039675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 979 | Open in IMG/M |
3300021861|Ga0213853_10838196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 585 | Open in IMG/M |
3300022756|Ga0222622_10493046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 875 | Open in IMG/M |
3300022756|Ga0222622_10679392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 747 | Open in IMG/M |
3300022886|Ga0247746_1065317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 854 | Open in IMG/M |
3300022915|Ga0247790_10021820 | Not Available | 1377 | Open in IMG/M |
3300023169|Ga0247762_1053632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1124 | Open in IMG/M |
3300024288|Ga0179589_10110159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1136 | Open in IMG/M |
3300025290|Ga0207673_1042155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 642 | Open in IMG/M |
3300025315|Ga0207697_10528819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 519 | Open in IMG/M |
3300025461|Ga0208851_1065873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 618 | Open in IMG/M |
3300025900|Ga0207710_10581473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 585 | Open in IMG/M |
3300025900|Ga0207710_10607343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 572 | Open in IMG/M |
3300025907|Ga0207645_10336929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1008 | Open in IMG/M |
3300025911|Ga0207654_10145693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1515 | Open in IMG/M |
3300025913|Ga0207695_10112387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2702 | Open in IMG/M |
3300025914|Ga0207671_10516318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 952 | Open in IMG/M |
3300025924|Ga0207694_10294392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1335 | Open in IMG/M |
3300025925|Ga0207650_10231272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1491 | Open in IMG/M |
3300025941|Ga0207711_10824165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 864 | Open in IMG/M |
3300025960|Ga0207651_11534361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 600 | Open in IMG/M |
3300025972|Ga0207668_10497963 | Not Available | 1048 | Open in IMG/M |
3300026041|Ga0207639_10028339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4088 | Open in IMG/M |
3300026041|Ga0207639_10191278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1748 | Open in IMG/M |
3300026041|Ga0207639_10203889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1698 | Open in IMG/M |
3300026067|Ga0207678_10500591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1059 | Open in IMG/M |
3300026118|Ga0207675_101374182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 727 | Open in IMG/M |
3300026118|Ga0207675_101488530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 698 | Open in IMG/M |
3300026121|Ga0207683_11864722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
3300026334|Ga0209377_1194055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 687 | Open in IMG/M |
3300026552|Ga0209577_10791825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 530 | Open in IMG/M |
3300026557|Ga0179587_11039115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 539 | Open in IMG/M |
3300027388|Ga0208995_1050039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 736 | Open in IMG/M |
3300027512|Ga0209179_1061409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 816 | Open in IMG/M |
3300027530|Ga0209216_1026790 | Not Available | 916 | Open in IMG/M |
3300027590|Ga0209116_1142342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 522 | Open in IMG/M |
3300027616|Ga0209106_1020257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1445 | Open in IMG/M |
3300027633|Ga0208988_1147268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 568 | Open in IMG/M |
3300027853|Ga0209274_10379173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 730 | Open in IMG/M |
3300027870|Ga0209023_10004006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 17115 | Open in IMG/M |
3300028379|Ga0268266_12305727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 510 | Open in IMG/M |
3300028380|Ga0268265_11191032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 759 | Open in IMG/M |
3300028536|Ga0137415_10000787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 31034 | Open in IMG/M |
3300028536|Ga0137415_10300816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1408 | Open in IMG/M |
3300028711|Ga0307293_10127414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 810 | Open in IMG/M |
3300028714|Ga0307309_10114651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 655 | Open in IMG/M |
3300028786|Ga0307517_10000542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 64617 | Open in IMG/M |
3300028794|Ga0307515_10165420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2232 | Open in IMG/M |
3300028794|Ga0307515_10582248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 729 | Open in IMG/M |
3300028802|Ga0307503_10899139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 512 | Open in IMG/M |
3300028807|Ga0307305_10063787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1699 | Open in IMG/M |
3300028811|Ga0307292_10201394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 818 | Open in IMG/M |
3300028814|Ga0307302_10526692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas endophytica | 587 | Open in IMG/M |
3300028828|Ga0307312_11185063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
3300028881|Ga0307277_10454142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 574 | Open in IMG/M |
3300030114|Ga0311333_10407486 | Not Available | 1101 | Open in IMG/M |
3300030514|Ga0268253_10099415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 843 | Open in IMG/M |
3300030522|Ga0307512_10307776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 732 | Open in IMG/M |
3300030739|Ga0302311_10062507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3148 | Open in IMG/M |
3300031446|Ga0170820_13280111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
3300031446|Ga0170820_14549941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 620 | Open in IMG/M |
3300031456|Ga0307513_10046551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4727 | Open in IMG/M |
3300031507|Ga0307509_10511417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 884 | Open in IMG/M |
3300031548|Ga0307408_101086788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 741 | Open in IMG/M |
3300031562|Ga0310886_10115735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1361 | Open in IMG/M |
3300031616|Ga0307508_10064896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3218 | Open in IMG/M |
3300031708|Ga0310686_116337840 | Not Available | 1137 | Open in IMG/M |
3300031730|Ga0307516_10528802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. | 833 | Open in IMG/M |
3300031731|Ga0307405_10598094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 900 | Open in IMG/M |
3300031731|Ga0307405_11229905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 649 | Open in IMG/M |
3300031852|Ga0307410_10359522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1166 | Open in IMG/M |
3300031854|Ga0310904_10472280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 836 | Open in IMG/M |
3300031902|Ga0302322_100315945 | Not Available | 1762 | Open in IMG/M |
3300031911|Ga0307412_10474536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1036 | Open in IMG/M |
3300031911|Ga0307412_11398184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 633 | Open in IMG/M |
3300031995|Ga0307409_100481229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1205 | Open in IMG/M |
3300032005|Ga0307411_11139082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 705 | Open in IMG/M |
3300032205|Ga0307472_102724482 | Not Available | 505 | Open in IMG/M |
3300033180|Ga0307510_10032398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5888 | Open in IMG/M |
3300033433|Ga0326726_10303322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1499 | Open in IMG/M |
3300034268|Ga0372943_0304676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1012 | Open in IMG/M |
3300034384|Ga0372946_0451738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 624 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.61% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 4.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.15% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.15% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.15% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.70% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.25% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.25% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.25% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.80% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.35% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.35% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.35% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.35% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.90% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.90% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.90% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.45% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.45% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.45% |
Liquid | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.45% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.45% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.45% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.45% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.45% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.45% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.45% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.45% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.45% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.45% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.45% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.45% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.45% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.45% |
Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.45% |
Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002184 | Freshwater and sediment microbial communities from Lake Erie, Canada | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Host-Associated | Open in IMG/M |
3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009351 | Microbial communities from sand-filter backwash in Singapore swimming pools - PR-1 | Engineered | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010052 | Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Host-Associated | Open in IMG/M |
3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015202 | Arctic sediment microbial communities from supraglacial cryoconite, Storglaci?ren, Tarfala, Sweden (Sample st-12a, ablation zone cryoconite) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023169 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027530 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Host-Associated | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F47_07977970 | 2170459009 | Grass Soil | MCLIHRDFKHFATSKANHFPHRRKVSSIMRAKVLSIMLLDAP |
JGI10216J12902_1084947501 | 3300000956 | Soil | MCLIHRDFKHFAAPKANHFRHRIKDSSIMRAKLLSIMRAEAAPVTSG* |
JGI12053J15887_100154266 | 3300001661 | Forest Soil | LEANRQTLQMCLIHRDFKHFAPAKAIDFHNPRKDSSIMRAKVLSIMRNDARRVRAD* |
JGI24770J26754_100252635 | 3300002184 | Freshwater And Sediment | MCPIHRDFKHFAASNANHFRHRGNLSSIMWAKVLSIMRAEARQVTMG* |
C688J35102_1206151092 | 3300002568 | Soil | MYLIHRDFKHFAPAKAIDFQDLRKNSSIMRANVLSIMRKDAQRVTAG* |
JGI25153J46596_100057362 | 3300003215 | Arabidopsis Rhizosphere | MCLIHRDFKHFAPPNAKQFRHLRKVSSIMRAKVLSIMRGDQGQVTSP* |
JGI25153J46596_100556431 | 3300003215 | Arabidopsis Rhizosphere | QMCLIHRDFKHFAPPNAKQFRHLRKVSSIMRAKVLSIMRGDQGQVTSP* |
rootL2_101360172 | 3300003322 | Sugarcane Root And Bulk Soil | MCLIHRDFKHFAAAKAINFALHRNLPSIIRAKVLSIMRKEARPLRRD* |
Ga0062591_1009739711 | 3300004643 | Soil | MCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGRVRTS* |
Ga0062382_101820751 | 3300004782 | Wetland Sediment | CLIHLDFKHFASPNARQFRHLRKVSSIMCAKVLSIMLPEARRVTSP* |
Ga0066671_100281743 | 3300005184 | Soil | MCLIHRDFKHFAPAKAINFACARKVSSIMQTKVLSIMRPDGRPLRRD* |
Ga0070676_103834652 | 3300005328 | Miscanthus Rhizosphere | MCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGQVRTS* |
Ga0070677_103957432 | 3300005333 | Miscanthus Rhizosphere | MCLIHGDFKHFDASKANHFRHRSKDSSIMRAKLLSIMRASTRPVTMG* |
Ga0070680_1006305042 | 3300005336 | Corn Rhizosphere | MCLIHGDFKHFATPNAKQFRHLRKDSSIMRAKVLSIMPPDAGRVTSP* |
Ga0070668_1013680382 | 3300005347 | Switchgrass Rhizosphere | QMCLIHRDFKHFTAGKATNFRGLRKVSSIMRAKVLSIMQAEAGQVRTS* |
Ga0070671_1004008163 | 3300005355 | Switchgrass Rhizosphere | DFKHFAMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGRVTSP* |
Ga0070674_1011659152 | 3300005356 | Miscanthus Rhizosphere | LPADTLTQQMCLIHRDFKHFTAGKATNFRGKSKVSSIMQAKVLSIM |
Ga0070673_1018653232 | 3300005364 | Switchgrass Rhizosphere | AESLTHQMCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGRVRTS* |
Ga0070701_106523451 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GANRQTHQMCLIHRDFKHFASPNTKHFRLWRKVSSIMRAKVLSIMRGDPGQVTSP* |
Ga0066689_106747272 | 3300005447 | Soil | GDFKHFATPNAKHFRHLRKVSSIMRAKVLSIMRGDPGQVTSP* |
Ga0070678_1013323742 | 3300005456 | Miscanthus Rhizosphere | MSLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGRVRTS* |
Ga0068867_1016183371 | 3300005459 | Miscanthus Rhizosphere | MCLIHRDFKHFAGSKANHFRHLRKDSSIMRAKLLSIMRASTRPVTMG* |
Ga0070698_1011367752 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MCLIHRDFKHFARAKAIDFRHLCKNSSIMRAKVLSIMRADAQPVRSD* |
Ga0077121_104803001 | 3300005511 | Arabidopsis Rhizosphere | QMCLIHRDFKHFATANAIQFRRWRKVSSIMCAKVLSIMREDPARVTSP* |
Ga0070741_100241423 | 3300005529 | Surface Soil | MCLIHGDFKHFQPTRTKQFRHHGKVSSIMRAKALSIMSANEAAVTGD* |
Ga0070738_100208646 | 3300005531 | Surface Soil | MCLIHGDFKHFQPPRTKQFRHHGKVSSIMRAKALSIMSANEAAVTGD* |
Ga0068853_1003502102 | 3300005539 | Corn Rhizosphere | MCLIHRDFKHFAASKANHFQYQSNDSSIMHAKVLSIMLPEAGEVTTG* |
Ga0070672_1016721042 | 3300005543 | Miscanthus Rhizosphere | MCLIHREFKHFAAQNTKQFRHFRKVSSIMRAKVLSIMLPESGQVTSP* |
Ga0066692_102281962 | 3300005555 | Soil | MCLIHRDFKHFAWAKAINFRPRRKVSSIMRAKVLSIMQAEGRRLRRD* |
Ga0066700_103135321 | 3300005559 | Soil | QMCLIHGDFKHFATPNAKHFRHLRKVSSIMRAKVLSIMRGDPGQVTSP* |
Ga0068857_1004430692 | 3300005577 | Corn Rhizosphere | MCLIHREFKHFAPPNAKQFRHFRKVSSIMRAKVLSIMR* |
Ga0070761_107327011 | 3300005591 | Soil | MCLIHKHFKHFAGSIPKNFRLSRKVSSSMRAKVLSIMPADARRVTTD* |
Ga0068859_1030241152 | 3300005617 | Switchgrass Rhizosphere | MCLIHGDFKHFAMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGRVTSP* |
Ga0068864_1025077031 | 3300005618 | Switchgrass Rhizosphere | MCLIHGDFKHFAPPNAKHFRHCGKVSSIMRAKVLSIM |
Ga0068860_1018207811 | 3300005843 | Switchgrass Rhizosphere | IHGDFKHFAMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGRVTSP* |
Ga0068862_1005980011 | 3300005844 | Switchgrass Rhizosphere | MCLIHRDFKHFAVPNAIQFQYFRKVSSIMRAKVLSIMR |
Ga0081540_13337992 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MQMCLIHGDFKHLAPAKAIDFPLPRNDSSIMRTKVLSIMRGDGRRVRTD* |
Ga0081539_101504472 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MCLIHRDFKHFARPNANQFRHLRKVSSIMHAKVLSIMREDQWQVTSP* |
Ga0073924_10509731 | 3300005992 | Sand | MKEGLAAHRQGVQMCLIHRDFKHFTTANTNDFRHCRKVSSIMWAKVLSIMRAVAGQVTPP |
Ga0075023_1001968622 | 3300006041 | Watersheds | MCLIHRDFKHFAASKANHFRLRRKDSSIMHAKVLSIMRGDAGEVTTG* |
Ga0075368_101598162 | 3300006042 | Populus Endosphere | MCLIHRDFKHFTVPNAKQFRYLRKVSSIMRAKVLSIMLSDAGRVTSP* |
Ga0075363_1006905012 | 3300006048 | Populus Endosphere | MCLIHRDFKHFAAAKAINFGWAGKVPSIMRTKMLSIMRKEAQPLSRD* |
Ga0075370_106354422 | 3300006353 | Populus Endosphere | AGWDANQPTHQMCLIHRDFKHFDASKANHFQQSGKDSSIMRAKLLSIMRSSTRPVTMG* |
Ga0075021_101322713 | 3300006354 | Watersheds | HEMCLIHRDFKHFHVPKANDFRNFRNNASIMSAKVLSIMPAKAGPVTTD* |
Ga0069787_105356311 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MCLIHRDFKHFTPAKAINFAAFRKVSSIMRAKLLSIMRNDAGPLRRD* |
Ga0066660_112924222 | 3300006800 | Soil | MCLIHRDFKHFAASKANHFRHCRKLSSIMPAKDLSIMRADAGQVTSG* |
Ga0079221_114252402 | 3300006804 | Agricultural Soil | HRDFKHFAADKATNFQGPRKVSSIMQAKVLSIMQAEGRRVTTS* |
Ga0075425_1008557341 | 3300006854 | Populus Rhizosphere | QMCLIHRDFKHFARAKAINFGSSRKVSSIMRAKVLSIMRPEGRPLRRD* |
Ga0074063_100606343 | 3300006953 | Soil | HQMCLIHRDFKHFARAKAINFGSSRKVSSIMRAKVLSIMRPEDRPLRRD* |
Ga0099795_101661052 | 3300007788 | Vadose Zone Soil | MCLIHGDFKHFAAAKAIDFLGLRNNSSIMRAKVLSIMRKDARRVRAG* |
Ga0099795_104218092 | 3300007788 | Vadose Zone Soil | RQTLQMCLIHRDFKHFAPAKAIDFRDLRKNSSIMPAKVLSIMRKDAQRVTAG* |
Ga0099795_105141202 | 3300007788 | Vadose Zone Soil | LEANRQTLQMCLIHRDFKHFAPAKAIDFHNLRKDSSIMRAKVLSIMRKDARRVRAD* |
Ga0099795_105255562 | 3300007788 | Vadose Zone Soil | MCLIHGDFKHFATAKAIDFPARCKNSSIMRAKILSIMRKDARRVRAN* |
Ga0111539_122419541 | 3300009094 | Populus Rhizosphere | PDIEESGKTQAGKASQMCLIHRDFKHFAMPNGKQFRHFRKVSSIMLPDAGRVTSP* |
Ga0075418_126331462 | 3300009100 | Populus Rhizosphere | MCLIHGDFKHFAVAKAINFRLLRKNSSIMPAKVLSIMRVDAWRVRTD* |
Ga0066709_1045244501 | 3300009137 | Grasslands Soil | MCLIHRDFKHFAPAKAINFEALRKVSSIIRAKVLSIMQAEAGPLRCD* |
Ga0105243_107739092 | 3300009148 | Miscanthus Rhizosphere | MCLIHRDFKHFAASKANHFRYRSNDSSIMHAKVLSIMLPEAGEVTTG* |
Ga0075423_120831512 | 3300009162 | Populus Rhizosphere | MCLIHRDFKHFARANAINFPDACKVSSIMRAKLLSIMRAEAGALRPD* |
Ga0105241_124174162 | 3300009174 | Corn Rhizosphere | QMCLIHRDFKHFDASKANHFRLHGKDSSIMRAKLLSIMRASTRPVTMG* |
Ga0073936_102566651 | 3300009175 | Freshwater Lake Hypolimnion | MCRIHRDFKHFAAAKAINFGWVSNLPSIMRTKVLSIMQNDARQLRRD* |
Ga0105248_103230783 | 3300009177 | Switchgrass Rhizosphere | MCLIHGDFKHFAEAKANHFRHLGKNSSIMRAKLLSIMRAERRQVTSD* |
Ga0115924_10016692 | 3300009351 | Swimming Pool Sandfilter Backwash | MCLIPGDFKHFAPPNAKQFRHLRKVSSIMRAKVLSIMRADPGRVTTP* |
Ga0105238_113854082 | 3300009551 | Corn Rhizosphere | EAGSGAKQQPHQMCLIHRDFKHFAASKANHFQYQSNDSSIMHAKVLSIMLPEAGEVTTG* |
Ga0105238_114522481 | 3300009551 | Corn Rhizosphere | MCLIHRDFKHFAAAKAINFGWVRKVSSIMRAKVLSIMRKEARPLSRD* |
Ga0105249_118213551 | 3300009553 | Switchgrass Rhizosphere | MCLIHRYFKHFAPAKAIDFRDLRKNSSIMRAKVLSIMRKDAQRVTAG* |
Ga0116224_104345961 | 3300009683 | Peatlands Soil | MCLIHGDFKHFHAAKAKDFRFRCKVSSIMRAKLLSIM |
Ga0126315_105693922 | 3300010038 | Serpentine Soil | MCLIHRDFKHFAPAKAIDFRDLRKNSSIMRAKVLSIMRKDAQRVTAG* |
Ga0126314_102509922 | 3300010042 | Serpentine Soil | MCLIHRDFKHFAPAKAIDFHNLRKNSSIMRAKVLSIMRKDARRVRAG* |
Ga0126382_119159291 | 3300010047 | Tropical Forest Soil | FKHFTLPNAKHFLHLSKVSAIMRAKVLSIRAGDPGRVTSP* |
Ga0133944_100029319 | 3300010052 | Liquid | MCLIHGDFKHFAASKANHFRLQGKNSSIMYAKLLSIMRAETGLVTSG* |
Ga0099796_101402082 | 3300010159 | Vadose Zone Soil | LEANRQTLQMCLIHRDFKHFAPAKAIDFHNPRKDSSIMRAKVLSIMRKDARRVRAD* |
Ga0099796_105015331 | 3300010159 | Vadose Zone Soil | MCLIHRDFKHFDASKANHFRLRSKDSSIMRAKLLSIMRAKTR |
Ga0126306_110372072 | 3300010166 | Serpentine Soil | MCLIHGDFKHFAASKANHFRHHGKKSSIMRDKLLSIMRVKTRRVTMG* |
Ga0134082_103348331 | 3300010303 | Grasslands Soil | LIHREFKHFAPPNAKHFRHLRKVSSIMRAKVLSIMLPDAGRVTSP* |
Ga0126370_117231981 | 3300010358 | Tropical Forest Soil | MCLIHSDFKHFALAKAINFAFARKVSSIMRAKVLSIMRKEGRPLRRD* |
Ga0126376_113351892 | 3300010359 | Tropical Forest Soil | MCLIHRDFKHFAAAKAINFALQRNLPSIIRAKVLSIMQKEP* |
Ga0126377_135365252 | 3300010362 | Tropical Forest Soil | MCLIHRDFKHFAAAKAINFALSRKVPSIMRAKVLSIMQAERSSLRRD* |
Ga0134126_115750031 | 3300010396 | Terrestrial Soil | MCLIHRDFKHFATPNAKQFRHLRKDSSIMRAKLLSIMRAEATQVTMG* |
Ga0134127_109185552 | 3300010399 | Terrestrial Soil | MCLIHREFKHFGAPNAKQFRHFRKVSSIMRAKVLSIMR* |
Ga0134122_111662542 | 3300010400 | Terrestrial Soil | MCLIHRDFKHFAAAKAINFEWGRKVSSIMRTKVLSIMRKEARPLSRD* |
Ga0134121_116893292 | 3300010401 | Terrestrial Soil | MELNPQTLQMCLIHGDFKHFAEAKANHFRHLGKNSSIMRAKLLSIMRAEATQVTMG* |
Ga0137391_115747032 | 3300011270 | Vadose Zone Soil | LDANRLHYQMCLIHRDFKHFARAKAINFADDCKDSSIMPAKLLSIMRADAQAVRSD* |
Ga0153943_11010941 | 3300012177 | Attine Ant Fungus Gardens | MCLIHGDFKHFAAAKAIDFLDLRNNSSIMRAKVLSIMRKDARRVRAG* |
Ga0137362_107872542 | 3300012205 | Vadose Zone Soil | MCLIHREFKHFNGAKTKDFRVRRKVPSIMSAKVLSIMRADAHPVTAD* |
Ga0150984_1118174351 | 3300012469 | Avena Fatua Rhizosphere | MYVIHRDFKHFAPAKAIDFQDLRKNSSIMRANVLSIMRKDAQRVTAG* |
Ga0157317_10127992 | 3300012475 | Arabidopsis Rhizosphere | HRDFKHFTASNANHFRHRGNVSSIMSAKVLSIMRAEARQVTIGLPAFLS* |
Ga0157331_10144431 | 3300012486 | Soil | QTHQMCLIHREFKHFAPPNAKQFRHFRKVSSIMRAKVLSIMR* |
Ga0157303_101963581 | 3300012896 | Soil | EGGLGANRQTHQMCLIHGYFKHLAPPNAKHFRYCGKVSSIMRAKVLSIMPPDAGRVTSP* |
Ga0157290_103910191 | 3300012909 | Soil | HQMCLIHRDFKHFAGAKANHFRHLRKDSSIMRAKLLSIMRAKRRRVTMG* |
Ga0137394_102022161 | 3300012922 | Vadose Zone Soil | DFKHFATAKAIDFPARCKNSSIMRAKILSIMRKDARRVRAN* |
Ga0137359_107983002 | 3300012923 | Vadose Zone Soil | MCLIHGDFKHFAAPKANHFRLHGKDSSIMRAKLLSIMRVKTRPVTSG* |
Ga0137413_100209435 | 3300012924 | Vadose Zone Soil | LEANRQTLQMCLIHRDFKHFAPAKAIDFRDLRKNSSIMRAKVLSIMRKDAQRVTAG* |
Ga0137419_112907752 | 3300012925 | Vadose Zone Soil | MCLIHGDFKHFATAKAIDFPALCKNSSIMRAKVLSIMRKDARRVRAG* |
Ga0137416_100197503 | 3300012927 | Vadose Zone Soil | MCLIHSEFKHFAPAKAKQFRLSLKVSSIMRAKVLSIMRAEAAPVTPS* |
Ga0137404_113947482 | 3300012929 | Vadose Zone Soil | MCLIHGDFKHFAAAKAIDFRDLRNNSSIMRAKVLSIMRKDARRVRAG* |
Ga0137407_122189312 | 3300012930 | Vadose Zone Soil | MCPIHGDFKHFYGTKAKHFRVHRKVPSIMRAKVLSIMRTDAGPVTAD* |
Ga0162651_1000861422 | 3300012938 | Soil | MCLIDRDFKHFAMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGRVTSP* |
Ga0137410_110293171 | 3300012944 | Vadose Zone Soil | MCLIHKDFKHYARPNARQFRHSSNISSIMRAKVLSIMRVNAGQVTAD* |
Ga0137410_110633482 | 3300012944 | Vadose Zone Soil | MCLIHRDFKHFAPAKAIDFHNLRKDSSIMRAKVLSIMRKDARRVRAG* |
Ga0164298_100736721 | 3300012955 | Soil | MCLIHRDFKHFTLPNAKHFRHLRKVSSIMRAKVLSIMQAEGRQLRRD* |
Ga0164299_100551793 | 3300012958 | Soil | GQGANRLTLQMCLIHGDFKHFAAAKAIDFLDLRNNSSIMRAKVLSIMRKDARRVRAG* |
Ga0164301_101639201 | 3300012960 | Soil | MCLIHGDFKHFAAAKAIDFLDLRNNSSIMRAKVLSIMRSSPALVTAD* |
Ga0134077_101331552 | 3300012972 | Grasslands Soil | MCLIHRDFKHFAPPNAKHFRHLRKVSSIMRAKVLSIMR* |
Ga0164308_103742151 | 3300012985 | Soil | ETLIHQMCLIHRDFKHFTADKAIKFRCRRKVSSIMQAKVLSIMQAKGRRVTTS* |
Ga0164307_119155241 | 3300012987 | Soil | MCPIHGDFKHFARANAILFRRLRKVSSIMCAKVLSIMREDQVRVTSP |
Ga0157378_129557362 | 3300013297 | Miscanthus Rhizosphere | EESGKTQAGKVSQMCLIHRDFKHFTMPNGKQFRHFRKVSSIMLPDAGRVTSP* |
Ga0157372_130656121 | 3300013307 | Corn Rhizosphere | NRQTHQMCLIHGDFKHFAPPNAKHFRHCGKVSSIMRAKVLSIMLPDAGRVTSP* |
Ga0163163_119389132 | 3300014325 | Switchgrass Rhizosphere | MCLIHREFKHFAMPNGKQFRHFRKVSSIMYAKVLSIMLPDAGRVTSP* |
Ga0157379_106289712 | 3300014968 | Switchgrass Rhizosphere | MCLIHGDFKHFAEAKANHFRHLGKNSSIMRAKLLSIMRARQGG* |
Ga0173480_101843082 | 3300015200 | Soil | MCLIHGDFKHFATPNAKQFRHLRKDSSIMRAKVLSIMPPDA |
Ga0167663_10385892 | 3300015202 | Glacier Forefield Soil | MCLIHRDFKHFATPNAKQFRHLSKVSSIMSAKVLSIMQAEARRVTMG* |
Ga0137418_102036743 | 3300015241 | Vadose Zone Soil | MCLIHGDFKHFATAKAIDFPALCKNSSIMRAKVLSIMRKDARRVRAD* |
Ga0137412_100272822 | 3300015242 | Vadose Zone Soil | MYLIHRDFKHFAPAKAIDFPDLRKNSSIMRANVLSIMRKDAQRVTAG* |
Ga0137412_108230191 | 3300015242 | Vadose Zone Soil | MCLIHGDFKHFAAAKAIDFLGLRNNSSIMRAKVLSIMRKDA |
Ga0137403_115296712 | 3300015264 | Vadose Zone Soil | MCLIHGDFKHFDGSKANHFQLQSKNWSIMRAKVLSIMRAERRQVTMG* |
Ga0132258_138823742 | 3300015371 | Arabidopsis Rhizosphere | MCLIHRDFKHFAAAKAINFGWAGKVPSIMRTKVLSIMRKEARPLSRD* |
Ga0187820_12217891 | 3300017924 | Freshwater Sediment | MFLIHRDFKHFRTATAKQFRHHRKVSSIMRAKVLSIMPANERAVTGD |
Ga0190266_105654342 | 3300017965 | Soil | MCLIHREFKHFAMPNGKQFRHFRKVSSIMYAKVLSIMLPDAGRVTSP |
Ga0184620_100601471 | 3300018051 | Groundwater Sediment | LKRAGTQTGKVFQMCLIHGDFKHFTMPNGKQFRHFRKVSSIMCAKVLSIML |
Ga0184619_104733872 | 3300018061 | Groundwater Sediment | MCLIHRDFKHFARAKAIDFRHPRKDSSIILAKVLSSMRKDPRAVRS |
Ga0184611_11689242 | 3300018067 | Groundwater Sediment | MCLIHGDFKHFAASKANHFRLRRKDSSIMRAKLLSIMRAETWRVTMG |
Ga0184632_103554741 | 3300018075 | Groundwater Sediment | MCLIHRDFKHFAAPKANHFRQLRKDSSIMRAKLLSIMRAKAAPVTMG |
Ga0184609_101694851 | 3300018076 | Groundwater Sediment | MCLIHGEFKHFAGPNAKHFRLSCKVSSIMRAKVLSIML |
Ga0066655_111325912 | 3300018431 | Grasslands Soil | LIHRDFKQFGPAKAINFARLRKVSSIMRAKVLSIMQAEGEPLRRD |
Ga0190268_114171772 | 3300018466 | Soil | MCLIHGDFKHFDASKANHFRHQSKNSSIMRAKLLSIMRAEATPVTSG |
Ga0190274_107626322 | 3300018476 | Soil | MCLIHGDFKHFDASKANHFRHQSKDSSIMRAKLLSIMRAEATPVTMS |
Ga0190274_109725362 | 3300018476 | Soil | MCLIHGDFKHFASPNAKHFRHCGKVSSIMRAKVLSIM |
Ga0190271_124304222 | 3300018481 | Soil | MCLIHGDFKHFDASKANHFRHRSKDSSIMRAKLLSIMRAEATPVTMG |
Ga0066669_112297632 | 3300018482 | Grasslands Soil | MCLIHRDFKHFAPAKAINFEALRKVSSIIRAKVLSIMQAEAGPLRCD |
Ga0173479_102384592 | 3300019362 | Soil | VSQMCLIHREFKHFAMPNGKQFRHFRKVSSIMYAKVLSIMLPDAGRVTSP |
Ga0173479_105126042 | 3300019362 | Soil | MCLIHRDFKHFRAANAIKFRPSRKVSSIMRAKVLSIMQAEAGRVRTS |
Ga0190264_101831082 | 3300019377 | Soil | MCLIHGDFKHFAKAKAIDFRHLCKNSSIISAKVLSIMRANAGPVRTD |
Ga0190264_116530841 | 3300019377 | Soil | MCLIHRDFKHFASPNAKQFRHFRNGSSIMSAKVLSIMRMDAGQVTAG |
Ga0193743_10451683 | 3300019889 | Soil | MCLIHGDFKHFAASKANHFRLHRKNSSIMRAKLLSIMRIKMRQVTMG |
Ga0179590_10890052 | 3300020140 | Vadose Zone Soil | MCLIHGDFKHFAAAKAIDFLGLRNNSSIMRAKVLSIMRKDARRVRAG |
Ga0179592_104877262 | 3300020199 | Vadose Zone Soil | MCLIHGDFKHFATAKAIDFPALCKNSSIMRAKVLSIMRKDARRVRAG |
Ga0179596_104210502 | 3300021086 | Vadose Zone Soil | MCLIHRDFKHFAPAKAIDFHNLRKDSSIMRAKVLSIMRKDARRVRAD |
Ga0222621_10396751 | 3300021510 | Groundwater Sediment | LKRAGTQTGKVFQMCLIHGDFKHFAMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGQVTSP |
Ga0213853_108381962 | 3300021861 | Watersheds | MCLIHADFKHFRKHKAKDFRDRGKVSSIMCAKLLSIMPTIA |
Ga0222622_104930462 | 3300022756 | Groundwater Sediment | CPQTHQMCLIHGDFKHFAASKANHFRLRRKDSSIMRAKLLSIMRAETWRVTMG |
Ga0222622_106793921 | 3300022756 | Groundwater Sediment | MCLIHRDFKHFAMPNAKQFRHLRKVSSIMRAKVLSIMLPDAGRVTSP |
Ga0247746_10653171 | 3300022886 | Soil | MCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGRVRTS |
Ga0247790_100218201 | 3300022915 | Soil | MCLIHRDFKHFATANATLFRRLRKVSSIMCAKVLSIMRED |
Ga0247762_10536321 | 3300023169 | Plant Litter | KHFAVPNAIQFQYFRKVSSIMRAKVLSIMREDPARVTSP |
Ga0179589_101101592 | 3300024288 | Vadose Zone Soil | MCLIHGDFKHFAAAKAIDFLDLRNNSSIMRAKVLSIMRKDARRVRAG |
Ga0207673_10421552 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | MCLIHRDFKHFTMPNGKQFRHFRKVSSIMQAKVLSIMQAEAGRVRTS |
Ga0207697_105288192 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | LTHQMCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGRVRTS |
Ga0208851_10658732 | 3300025461 | Arctic Peat Soil | MCLIHRDFKHFARPKAKHFHVSRKVSSIMPAKVLSIMPEEAGPVTAD |
Ga0207710_105814731 | 3300025900 | Switchgrass Rhizosphere | RGLGANRQTHQMCLIHREFKHFAPPNAKQFRHFRKVSSIMRAKVLSIMR |
Ga0207710_106073432 | 3300025900 | Switchgrass Rhizosphere | MCLIHRDFKHFAMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGRVTSP |
Ga0207645_103369292 | 3300025907 | Miscanthus Rhizosphere | MCLIHRDFKHFTAGKATNFRGQRKVSSIMQAKVLSIMQAEAGQVRTS |
Ga0207654_101456932 | 3300025911 | Corn Rhizosphere | MCLIHREFKHFAPPNAKQFRHFRKVSSIMRAKVLSIMR |
Ga0207695_101123871 | 3300025913 | Corn Rhizosphere | QTHQMCLIHRDFKHLAASNARQFRHCSKVSSIMSAKVLSIMRAEARQVTMG |
Ga0207671_105163182 | 3300025914 | Corn Rhizosphere | MCLIHGDFKHFATPNAKQFRHLRKDSSIMRAKVLSIMPPDAGRVTSP |
Ga0207694_102943922 | 3300025924 | Corn Rhizosphere | MCLIHRDFKHFAASKANHFRYQSNDSSIMHAKVLSIMLPEAGEVTTG |
Ga0207650_102312722 | 3300025925 | Switchgrass Rhizosphere | MCLIHREFKHFALPNAKQFRHFRKVSSIMRAKVLSIMR |
Ga0207711_108241651 | 3300025941 | Switchgrass Rhizosphere | MCLIHGDFKHFAEAKANHFRHLGKNSSIMRAKLLSIMRAERRQVTSD |
Ga0207651_115343612 | 3300025960 | Switchgrass Rhizosphere | ESQCAESLTHQMCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGRVRTS |
Ga0207668_104979632 | 3300025972 | Switchgrass Rhizosphere | MCLIHRDFKHFTAGKATNFRGLRKVSSIMRAKVLSIMQAEAGQVRTS |
Ga0207639_100283391 | 3300026041 | Corn Rhizosphere | RAGNADGKVSQMCLIHGDFKHFATPNAKQFRHLRKDSSIMRAKVLSIMPPDAGRVTSP |
Ga0207639_101912783 | 3300026041 | Corn Rhizosphere | MCLIHRDFKHFAASKANHFQYQSNDSSIMHAKVLSIMLPEAGEVTTG |
Ga0207639_102038892 | 3300026041 | Corn Rhizosphere | MCLIHGDFKHFATPNAKQFRHLRKDSSIMRAKVLSI |
Ga0207678_105005913 | 3300026067 | Corn Rhizosphere | SLTHQMCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEAGQVRTS |
Ga0207675_1013741821 | 3300026118 | Switchgrass Rhizosphere | TQAGKVSQMCLIHRDFKHFSMPNGKQFRHFRKVSSIMLPDAGRVTSP |
Ga0207675_1014885301 | 3300026118 | Switchgrass Rhizosphere | MCLIHRDFKHFKAGKATNFRLLRKVSSIMQAKVLSIMQAEA |
Ga0207683_118647221 | 3300026121 | Miscanthus Rhizosphere | MCLIHRDFKHFAAAKAINFGWVRKVSSIMRTKVLSIMRKEARPLSRD |
Ga0209377_11940552 | 3300026334 | Soil | MCLIHRDFKHFAWAKAINFRPRRKVSSIMRAKVLSIMQAEGRRLRRD |
Ga0209577_107918251 | 3300026552 | Soil | MCLIHRDFKHFAASKANHFRHCRKLSSIMPAKDLSIMRADAGQVTSG |
Ga0179587_110391152 | 3300026557 | Vadose Zone Soil | MCLIHGDFKHFATAKAIDFPARCKNSSIMRAKILSIMRKDARRVRAN |
Ga0208995_10500392 | 3300027388 | Forest Soil | LEANRQTLQMCLIHRDFKHFAPAKAIDFHNPRKDSSIMRAKVLSIMRKDARRVRAD |
Ga0209179_10614092 | 3300027512 | Vadose Zone Soil | LEANRQTLQMCLIHRDFKHFAPAKAIDFHNLRKDSSIMRAKVLSIMRKDARRVRAD |
Ga0209216_10267902 | 3300027530 | Forest Soil | MCLIHRDFKHFARSNAINFAAARKVSSIMRAKLLSIMQAEAGALRRD |
Ga0209116_11423421 | 3300027590 | Forest Soil | MRFASLEMCLIHKHFKHFAGSIPKNFRLRRKVSSSMRAKVLSIMPADAGRVTSD |
Ga0209106_10202573 | 3300027616 | Forest Soil | MCLIHRDFKHFAPAKAIDFHNPRKDSSIMRAKVLSIMRNDARRVRAD |
Ga0208988_11472681 | 3300027633 | Forest Soil | QMCLIHRDFKHFAPAKAIDFHNPRKDSSIMRAKVLSIMRKDARRVRAD |
Ga0209060_103481732 | 3300027826 | Surface Soil | LIHRDFKHFPTATAKQFRHHRKVSSIMRAKVLSIMPANERAVTGD |
Ga0209274_103791732 | 3300027853 | Soil | MCLIHKHFKHFAGSIPKNFRLSRKVSSSMRAKVLSIMPADARRVTTD |
Ga0209023_1000400617 | 3300027870 | Freshwater And Sediment | MCPIHRDFKHFAASNANHFRHRGNLSSIMWAKVLSIMRAEARQVTMG |
Ga0209062_10275644 | 3300027965 | Surface Soil | MCLIHGDFKHFQPPRTKQFRHHGKVSSIMRAKALSIMSANEAAVTGD |
Ga0209168_100605752 | 3300027986 | Surface Soil | MFLIHRDFKHFHTATAKQFRHHRKVSSIMRAKVLSIMPANERAVTGD |
Ga0268266_123057271 | 3300028379 | Switchgrass Rhizosphere | MCLIHRDFKHFAAAKAINFGWVRKVSSIMRAKVLSIMRKEARPLSRD |
Ga0268265_111910322 | 3300028380 | Switchgrass Rhizosphere | MCLIHRDFKHFARAKAIDFRHLCKNSSIMRAKVLSIMRADAQPVRSD |
Ga0137415_1000078722 | 3300028536 | Vadose Zone Soil | MCLIHSEFKHFAPAKAKQFRLSLKVSSIMRAKVLSIMRAEAAPVTPS |
Ga0137415_103008161 | 3300028536 | Vadose Zone Soil | LIHRDFKHFARAKAINFADDCKDSSIMPAKLLSIMRADAQAVRSD |
Ga0307293_101274141 | 3300028711 | Soil | MCLIHRDFKHFARAKAIDFRHPRKDSSIILAKVLSSMRKDPRAVRSD |
Ga0307309_101146511 | 3300028714 | Soil | MCLIHGDFKHFAASKANHFRHRSKDSSIMRAKLLSIMRAETWR |
Ga0307517_1000054210 | 3300028786 | Ectomycorrhiza | MCLIHGDFKHFAASKANHFRHHRKDSSIMRAKVLSIMRAEAAPVTSG |
Ga0307515_101654202 | 3300028794 | Ectomycorrhiza | MCLIHGDFKHFAASKANHFRHHRKDSSIMRAKVLSIMRAKTSQVTKG |
Ga0307515_105822481 | 3300028794 | Ectomycorrhiza | CLIHGDFKHFAMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGRVTSP |
Ga0307503_108991392 | 3300028802 | Soil | MCLIHRDFKHFAASKANHFRHRGKDSSIMRAKLLSIMRAEAAQVTSG |
Ga0307305_100637871 | 3300028807 | Soil | MCLIHRYFKHFAPAKAIDFRDLRKNSSIMRAKVLSIMRKDAQPVTAG |
Ga0307292_102013942 | 3300028811 | Soil | LKRAGTQTGKVFQMCLIHGDFKHFTMPNGKQFRHFRKVSSIMCAKVLSIMLPDAGRVTSP |
Ga0307302_105266921 | 3300028814 | Soil | LAANLQDYQMCLIHRDFKHFARAKAIDFRYPRKDSSIILAKVLSIMRKDARRVRAG |
Ga0307312_111850631 | 3300028828 | Soil | LAANLQDYQMCLIHRDFKHFARAKAIDFRHPRKDSSIILAKVLSIMRKDARRVRAG |
Ga0307277_104541421 | 3300028881 | Soil | MCLIHRYFKHFAPAKAIDFRDLRKNSSIMRAKVLSIMR |
Ga0311333_104074862 | 3300030114 | Fen | MCLIHRDFKHFARPKAKHFHVSRKVSSIMPAKVLSIMPEEPGPVTTD |
Ga0268253_100994152 | 3300030514 | Agave | HGDFKHFDGLKANHFRRCGKDSSIMRAKLLSIMRAERRRVTMG |
Ga0307512_103077762 | 3300030522 | Ectomycorrhiza | HFEASKANHFRHHSKDSSIMHAKLLSIMRAEATQVTSG |
Ga0302311_100625071 | 3300030739 | Palsa | MCLIHGDFKHFRTPEPEDFPTRGKVSSIMCAKVLSIMRAG |
Ga0170820_132801112 | 3300031446 | Forest Soil | MCLIHRDFKHFTAPIANDFRHSRKVSSIMWAKVLSIMRAEARQVTTG |
Ga0170820_145499412 | 3300031446 | Forest Soil | MCLIHGDFKHFDASKANHFRHHGKDSSIMRAKLLSIMRGNAGRVTMG |
Ga0307513_100465512 | 3300031456 | Ectomycorrhiza | MCLIHRDFKHFDAAKANHFRHHGKKSSIMHGKLLSIMRVKTRRVTMG |
Ga0307509_105114171 | 3300031507 | Ectomycorrhiza | GALQMCLIHRDFKHFARAKAINFGSSRKVSSIMRAKVLSIMRPEERPLRRD |
Ga0307408_1010867882 | 3300031548 | Rhizosphere | AFQMCLIHRDFKHFAMPNGKQFRHLRKVSSIICAKVLSIMLPDARRVTSP |
Ga0310886_101157352 | 3300031562 | Soil | MCLIHREFKHFAAQNTKQFRHFRKVSSIMRAKVLSIMLPESGQVTSP |
Ga0307508_100648963 | 3300031616 | Ectomycorrhiza | MCLIHGDFKHFATSKANHFPHCRKVSSIMRAKDLSIMRAKTAQVTMG |
Ga0310686_1163378402 | 3300031708 | Soil | MCLIHADFKHFQWSKTKDFRVCRKDSSIMWAKVLSIMRAEAGQVTPG |
Ga0307516_105288022 | 3300031730 | Ectomycorrhiza | MCLIHRDFKHFAASKANHFRHRSKDSSIMHAKVLSIMRAEAAPVTMG |
Ga0307405_105980942 | 3300031731 | Rhizosphere | MCLIHGDFKHFDASKANHFRLQSKNSSIMRAKLLSIMRAEAPQVTMG |
Ga0307405_112299051 | 3300031731 | Rhizosphere | MCLIHRDFKHFAASKANHFRQRGKDSSIMRAKLLSIMRAEAAPVTSG |
Ga0307410_103595222 | 3300031852 | Rhizosphere | MCLIHGDFKHFEPSKANHFRLQSKNSSIMRAKLLSIMRAEAAPVTSG |
Ga0310904_104722802 | 3300031854 | Soil | MCLIHRDFKHFTMPNGKQFRHFRKVSSIMLPDAGRVTSP |
Ga0302322_1003159451 | 3300031902 | Fen | MCLIHKDFKHFARIKANQFHAGRNVSSIMCAKVLSIMRANQRQVTPG |
Ga0307412_104745362 | 3300031911 | Rhizosphere | MCLIHRDFKHFDASKANHFRHQIKNSSIMRAKVLSIMRAKAAPVTMG |
Ga0307412_113981841 | 3300031911 | Rhizosphere | MCLIHGDFKHFDTSKANHFRLQSKDSSIMRAKLLSIMRAE |
Ga0307409_1004812292 | 3300031995 | Rhizosphere | MCLIHRDFKHFDASKANHFRHQIKNSSIMRAKVLSIMRAKAAPVTKG |
Ga0307411_111390822 | 3300032005 | Rhizosphere | MCLIHGDFKHFDTSKANHFRLQSKDSSIMRAKLLSIMRAEAAPVTSG |
Ga0307472_1027244821 | 3300032205 | Hardwood Forest Soil | MCLICRDFKHFAPAKAINFAAARKVSSIMQAKVLSIMRAEAGPLRRD |
Ga0307510_100323987 | 3300033180 | Ectomycorrhiza | MCLIHRDFKHFAASKANHFRHCGKDSSIMRAKVLSIMRADAPQVTMG |
Ga0326726_103033223 | 3300033433 | Peat Soil | AARAKPLTHQMCRIHRDFKHFAAAKAINFGWVSNLPSIMRTKVLSIMRKEARPLRRD |
Ga0372943_0304676_587_730 | 3300034268 | Soil | MCLIHGDFKHFAASKANHFRYRSKDSSIMRAKLLSIMRAKAAPVTMG |
Ga0372946_0451738_264_407 | 3300034384 | Soil | MCLIHGDFKHFAASKANHFRLHRKDSSIMRAKVLSIMRAKAAPVTMG |
⦗Top⦘ |