Scaffold Ga0133939_1072303

Overview

Basic Information

• Taxon OID: 3300010051
• Scaffold ID: Ga0133939_1072303
• Source Dataset Name: Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aalborg University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1614
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater → Industrial Wastewater Microbial Communities From Reactors Of Effluent Treatment Plant In South Killingholme, Immingham, England

Source Dataset Sampling Location

• Location Name: South Killingholme, Immingham, South Humberside, DN40 3DW, England
• Coordinates
  • Lat. (^o): 53.633367
  • Long. (^o): -0.251861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059402	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133939_10723032	F059402	N/A	MRAFMANILVTLFAVFLCLVNAVIWAFVSEMPLVGIAWVGAATFSYQLHKWSRN*