Basic Information | |
---|---|
Family ID | F059402 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 48 residues |
Representative Sequence | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCLFLQKWSRN |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 9.77 % |
% of genes near scaffold ends (potentially truncated) | 40.30 % |
% of genes from short scaffolds (< 2000 bps) | 85.07 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.328 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (8.209 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.284 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.731 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.41% β-sheet: 0.00% Coil/Unstructured: 43.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF13420 | Acetyltransf_4 | 28.36 |
PF13519 | VWA_2 | 20.15 |
PF00092 | VWA | 12.69 |
PF13302 | Acetyltransf_3 | 12.69 |
PF13207 | AAA_17 | 3.73 |
PF07883 | Cupin_2 | 1.49 |
PF13671 | AAA_33 | 1.49 |
PF09346 | SMI1_KNR4 | 1.49 |
PF10861 | DUF2784 | 0.75 |
PF07931 | CPT | 0.75 |
PF00903 | Glyoxalase | 0.75 |
PF07681 | DoxX | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.75 |
COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.75 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.33 % |
Unclassified | root | N/A | 15.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459020|G1P06HT01B0YCX | Not Available | 573 | Open in IMG/M |
3300001213|JGIcombinedJ13530_109114400 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300001431|F14TB_101246759 | Not Available | 573 | Open in IMG/M |
3300004079|Ga0055514_10042051 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300004157|Ga0062590_101239145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
3300004157|Ga0062590_101760200 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300004463|Ga0063356_104403728 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300004643|Ga0062591_102662654 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005293|Ga0065715_10214598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
3300005328|Ga0070676_10013725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4441 | Open in IMG/M |
3300005331|Ga0070670_100021657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5527 | Open in IMG/M |
3300005331|Ga0070670_101660531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
3300005338|Ga0068868_100617758 | Not Available | 962 | Open in IMG/M |
3300005340|Ga0070689_100619050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 939 | Open in IMG/M |
3300005340|Ga0070689_101292029 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300005343|Ga0070687_100404453 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300005355|Ga0070671_100351135 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300005367|Ga0070667_100595210 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
3300005440|Ga0070705_100272223 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300005445|Ga0070708_102169255 | Not Available | 513 | Open in IMG/M |
3300005455|Ga0070663_100296060 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300005459|Ga0068867_100106097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2152 | Open in IMG/M |
3300005468|Ga0070707_100776384 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300005471|Ga0070698_100680885 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300005543|Ga0070672_100129168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2075 | Open in IMG/M |
3300005543|Ga0070672_100540640 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300005548|Ga0070665_101307266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
3300005618|Ga0068864_100295680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1515 | Open in IMG/M |
3300005660|Ga0073904_10386256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 783 | Open in IMG/M |
3300005834|Ga0068851_10669349 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005840|Ga0068870_10326294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 977 | Open in IMG/M |
3300005841|Ga0068863_100591412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1098 | Open in IMG/M |
3300005841|Ga0068863_102562598 | Not Available | 519 | Open in IMG/M |
3300005842|Ga0068858_100251845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1678 | Open in IMG/M |
3300005937|Ga0081455_10955535 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300006056|Ga0075163_10630509 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300006163|Ga0070715_10284451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 878 | Open in IMG/M |
3300006237|Ga0097621_101295187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300006417|Ga0069787_11792989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
3300006642|Ga0075521_10021601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2628 | Open in IMG/M |
3300006755|Ga0079222_10849752 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300006755|Ga0079222_11327649 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300006854|Ga0075425_100449971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1483 | Open in IMG/M |
3300006954|Ga0079219_12387457 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009091|Ga0102851_12146449 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300009094|Ga0111539_12538940 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300009111|Ga0115026_11714829 | Not Available | 530 | Open in IMG/M |
3300009167|Ga0113563_10808285 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300009174|Ga0105241_11896920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
3300009553|Ga0105249_12058077 | Not Available | 644 | Open in IMG/M |
3300009868|Ga0130016_10000784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 68023 | Open in IMG/M |
3300009870|Ga0131092_10055778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5210 | Open in IMG/M |
3300009870|Ga0131092_10087747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3767 | Open in IMG/M |
3300009870|Ga0131092_10317347 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
3300009870|Ga0131092_10436951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1203 | Open in IMG/M |
3300009870|Ga0131092_11343479 | Not Available | 553 | Open in IMG/M |
3300009873|Ga0131077_10263035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1753 | Open in IMG/M |
3300010051|Ga0133939_1005116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 12874 | Open in IMG/M |
3300010051|Ga0133939_1072303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
3300010401|Ga0134121_10160463 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300012212|Ga0150985_116270766 | Not Available | 504 | Open in IMG/M |
3300012533|Ga0138256_10916695 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012985|Ga0164308_11383034 | Not Available | 642 | Open in IMG/M |
3300013296|Ga0157374_10618959 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300013297|Ga0157378_10557608 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300013308|Ga0157375_12415016 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300013769|Ga0119887_1010644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2877 | Open in IMG/M |
3300014502|Ga0182021_10911148 | Not Available | 1057 | Open in IMG/M |
3300014968|Ga0157379_11386743 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300014969|Ga0157376_12707129 | Not Available | 536 | Open in IMG/M |
3300015371|Ga0132258_10557123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2873 | Open in IMG/M |
3300015371|Ga0132258_11702829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1590 | Open in IMG/M |
3300015371|Ga0132258_12683417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1243 | Open in IMG/M |
3300015371|Ga0132258_13733175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1038 | Open in IMG/M |
3300015374|Ga0132255_104198208 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300017959|Ga0187779_10814740 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300018052|Ga0184638_1052085 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300018081|Ga0184625_10481323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300018476|Ga0190274_10163807 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
3300018476|Ga0190274_10721530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1044 | Open in IMG/M |
3300018481|Ga0190271_10916245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
3300018481|Ga0190271_11735719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 737 | Open in IMG/M |
3300018481|Ga0190271_12713188 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300022756|Ga0222622_11119326 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300025321|Ga0207656_10504528 | Not Available | 614 | Open in IMG/M |
3300025893|Ga0207682_10094968 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300025899|Ga0207642_10222040 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300025899|Ga0207642_10934952 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300025901|Ga0207688_10266636 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300025923|Ga0207681_10057954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2650 | Open in IMG/M |
3300025925|Ga0207650_10251402 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300025925|Ga0207650_10594100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 930 | Open in IMG/M |
3300025925|Ga0207650_11285745 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300025926|Ga0207659_10146252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1840 | Open in IMG/M |
3300025926|Ga0207659_11412440 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300025940|Ga0207691_11405953 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300025945|Ga0207679_11084608 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300026035|Ga0207703_10092967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2540 | Open in IMG/M |
3300026088|Ga0207641_10614302 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300026088|Ga0207641_10955102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
3300026089|Ga0207648_11247665 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300026095|Ga0207676_11872699 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300026142|Ga0207698_12187383 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300027716|Ga0209682_10067345 | Not Available | 879 | Open in IMG/M |
3300027885|Ga0209450_10211411 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300027897|Ga0209254_10107421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2333 | Open in IMG/M |
3300027897|Ga0209254_10522038 | Not Available | 854 | Open in IMG/M |
3300027899|Ga0209668_10013835 | All Organisms → cellular organisms → Bacteria | 3848 | Open in IMG/M |
3300027900|Ga0209253_10002417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16545 | Open in IMG/M |
3300028379|Ga0268266_11980168 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300028380|Ga0268265_10109243 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
3300028380|Ga0268265_10405582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1261 | Open in IMG/M |
3300028381|Ga0268264_10237860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1685 | Open in IMG/M |
3300031521|Ga0311364_11110838 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300031521|Ga0311364_11453754 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300031726|Ga0302321_100095463 | All Organisms → cellular organisms → Bacteria | 2968 | Open in IMG/M |
3300031731|Ga0307405_10053159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2522 | Open in IMG/M |
3300031852|Ga0307410_11331226 | Not Available | 629 | Open in IMG/M |
3300031911|Ga0307412_12086270 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031918|Ga0311367_10234698 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
3300031995|Ga0307409_102861851 | Not Available | 510 | Open in IMG/M |
3300032002|Ga0307416_102450164 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300032143|Ga0315292_10229332 | Not Available | 1528 | Open in IMG/M |
3300032157|Ga0315912_11491627 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300032829|Ga0335070_10732016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 923 | Open in IMG/M |
3300033408|Ga0316605_10390807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
3300033418|Ga0316625_100593076 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300033418|Ga0316625_101864118 | Not Available | 586 | Open in IMG/M |
3300033482|Ga0316627_100761371 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300034157|Ga0370506_075337 | Not Available | 733 | Open in IMG/M |
3300034177|Ga0364932_0218557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
3300034358|Ga0370485_0326134 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300034965|Ga0370497_0167172 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.21% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.48% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.73% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.73% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.73% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 3.73% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.99% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.24% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.49% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.49% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.49% |
Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 1.49% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.75% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.75% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.75% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.75% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.75% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.75% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.75% |
Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 0.75% |
Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.75% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013769 | Sewage treatment plant microbial communities from Vermont, USA - Sand_B | Engineered | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2NP_02514560 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | MANIFVCLFAVTLCLVNAVIWAFISEMPLMGIAWVGCAG |
JGIcombinedJ13530_1091144001 | 3300001213 | Wetland | MANIFVTLFAVALCLVNAVVWTFISELPLMGVCWVGAAAFCLFLHKWSKG* |
F14TB_1012467591 | 3300001431 | Soil | MGNIIVCLFAVTLCLVNAVIWAFFSEMLLVGLGWVGAAAFCMFLQKWSKY* |
Ga0055514_100420512 | 3300004079 | Natural And Restored Wetlands | MANIFVTLFAVILCLINAVIWAFISLMPLVGVGWVGAAAGCLWLHKWSRY* |
Ga0062590_1012391452 | 3300004157 | Soil | MANIFVCLFAVTLCLTNAVIWAFFSEMRIVGLCWVAAAAFCLFLQKWSRY* |
Ga0062590_1017602002 | 3300004157 | Soil | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSRY* |
Ga0063356_1044037282 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKY* |
Ga0062591_1026626541 | 3300004643 | Soil | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG* |
Ga0065715_102145982 | 3300005293 | Miscanthus Rhizosphere | VTNILVCVFAVALCLVNAVIWAFISQMPFVGLSWVGAAAACLVLQKWAKG* |
Ga0070676_100137257 | 3300005328 | Miscanthus Rhizosphere | VTNILVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG* |
Ga0070670_10002165710 | 3300005331 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLINAVIWAFFSEMRIVGLCWVAAAAFCLFLQKWSRY* |
Ga0070670_1016605312 | 3300005331 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWAKG* |
Ga0068868_1006177582 | 3300005338 | Miscanthus Rhizosphere | LVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG* |
Ga0070689_1006190502 | 3300005340 | Switchgrass Rhizosphere | LVGDHVTNILVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG* |
Ga0070689_1012920292 | 3300005340 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLLNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKY* |
Ga0070687_1004044531 | 3300005343 | Switchgrass Rhizosphere | DHVTNILVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG* |
Ga0070671_1003511351 | 3300005355 | Switchgrass Rhizosphere | AAARARIALMANIFVCLFAVTLCLINAVIWAFMSEMPFVGLAWVGAAAFCLFLQKWSRN* |
Ga0070667_1005952102 | 3300005367 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLINAVIWAFMSEMLFVGLGWVGAAAFCLFLQKWSRF* |
Ga0070705_1002722232 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MANIFVCVFAVALCLMNAVIWTFMSQMPLVGVCWVGAAAGCYALQKWSRG* |
Ga0070708_1021692552 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNILVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLAMQKWAKG* |
Ga0070663_1002960602 | 3300005455 | Corn Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFISEMPLMGIAWVGCAGFCLFLQKWSKG* |
Ga0068867_1001060971 | 3300005459 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKW |
Ga0070707_1007763842 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PCGHRLVGDHVTNILVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG |
Ga0070698_1006808851 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNILVCVFAVALCLLNAVIWAFVSDRLFIGLGWVGAAALCLVLQKWQKG* |
Ga0070672_1001291683 | 3300005543 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLLNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG* |
Ga0070672_1005406401 | 3300005543 | Miscanthus Rhizosphere | PTTSGSMANIFVCLFAVTLCLVNAVIWAFISEMPLMGIAWVGCAGFCLFLQKWSKG* |
Ga0070665_1013072662 | 3300005548 | Switchgrass Rhizosphere | MANIFVCLFAVSLCLINAVIWAFFSDMRVVGLCWVGAAAFCLFLQKWSRY* |
Ga0068864_1002956801 | 3300005618 | Switchgrass Rhizosphere | APDLMANIFVCLFAVSLCLINAVIWAFFSDMRVVGLCWVGAAAFCLFLQKWSRY* |
Ga0073904_103862562 | 3300005660 | Activated Sludge | MANIFVCLFAVMLCLVNAVIWAFISEMPLMGLAWVGCAGFCLFLQKWSKG* |
Ga0068851_106693491 | 3300005834 | Corn Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCVFLQKWAKG* |
Ga0068870_103262943 | 3300005840 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSRF* |
Ga0068863_1005914123 | 3300005841 | Switchgrass Rhizosphere | APDLMANIFVCLFAVTLCLTNAVIWAFFSEMRIVGLCWVAAAAFCLFLQKWSRY* |
Ga0068863_1025625981 | 3300005841 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFL |
Ga0068858_1002518452 | 3300005842 | Switchgrass Rhizosphere | MANIFVCLFAVSLCLINAVIWAFMSEMLFVGLGWVGAAAFCLFLQKWSRY* |
Ga0081455_109555352 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTNIFVCLFAVMLCLLNAVIWAFISERPFIGLCWVGAAALCLFLQKWSKF* |
Ga0075163_106305092 | 3300006056 | Wastewater Effluent | MANIIATLFAVGLCLVNAVIWAFVSEMPLIGLGWLGAAAGSLMLHKWAKG* |
Ga0070715_102844512 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MANIFVCLFAVSLCLINAVIWAFISEMPFVGLGWVGAAAFCLFLQKWSRY* |
Ga0097621_1012951872 | 3300006237 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCLFLQKWSRN* |
Ga0069787_117929892 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | APASVAAPASMANILVTLFAVFLCLVNAVIWAFVSEMPLVGIAWVGAATFSYQLHKWSRY |
Ga0075521_100216011 | 3300006642 | Arctic Peat Soil | MANIFVCLFAVTLCLLNAVIWAFASQMPFVGLCWVGAAAFCLFLQKWAK |
Ga0079222_108497522 | 3300006755 | Agricultural Soil | AVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG* |
Ga0079222_113276492 | 3300006755 | Agricultural Soil | VANIFVCLFAVTLCLLNAVIWAFMSEMLFVGLGWVGAAALCLFLQKWSRY* |
Ga0075425_1004499711 | 3300006854 | Populus Rhizosphere | MANIFVCLFAVTLCLINAVIWAFMSEMLFVGLGWVGAAAFCLFLQKWSKY* |
Ga0079219_123874571 | 3300006954 | Agricultural Soil | VANIFVCLFAVTLCLLNAVIWAFMSEMLFVGLGWVG |
Ga0102851_121464492 | 3300009091 | Freshwater Wetlands | FAVTLCLINAVIWAFVSGMPLVGVGWVGAAAGCLWLHKWSRF* |
Ga0111539_125389402 | 3300009094 | Populus Rhizosphere | VTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG* |
Ga0115026_117148291 | 3300009111 | Wetland | MANIFVTLFAVILCLINAVIWAFVSQMPLVGVGWVAAAAGCLWLHKWSRY* |
Ga0113563_108082852 | 3300009167 | Freshwater Wetlands | MANIFVTLFAVTLCLINAVIWAFVSGMPLVGVGWVGAAAGCLWLHKWSRF* |
Ga0105241_118969202 | 3300009174 | Corn Rhizosphere | VNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG* |
Ga0105249_120580772 | 3300009553 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLINAVIWAFMSEMLFVGLGWVGAAAFC |
Ga0130016_1000078465 | 3300009868 | Wastewater | MANIFVSLFAVMLCLVNAVIWTFISEMPLMGIAWVGGAVLCVYLQKWSKG* |
Ga0131092_100557787 | 3300009870 | Activated Sludge | AVTLCLVNAVIWTFFSEMFFVGLGWVGAAIFCVFLQKWSRY* |
Ga0131092_100877473 | 3300009870 | Activated Sludge | MANIFVTLFAVILCLINAVIWAFVSQMPLVGVGWVGAAAGCLWLHKWSRY* |
Ga0131092_103173472 | 3300009870 | Activated Sludge | MANILVTLFAVFLCLVNAVIWAFVSEMPLVGIAWVGAATFSYQLHKWSRY* |
Ga0131092_104369512 | 3300009870 | Activated Sludge | MTNIFVCLFAVVLCLINALIWTFMSQMLFVGLGWVGAAAFCLFLQKWSKY* |
Ga0131092_113434792 | 3300009870 | Activated Sludge | MANIFVSLFAVMLCLVNAVIWTFVSEMPLMGIVWVGCAGLCLYVQKWSNG* |
Ga0131077_102630354 | 3300009873 | Wastewater | MANILVTLFAVFLCLVNAVIWAFISEMPLVGIAWVGAATFSYQLHKWSRY* |
Ga0133939_10051168 | 3300010051 | Industrial Wastewater | MANIFVCLFAVLLCLVNAVIWAFISEMPVMGLAWVGCAGLCLFLQKWSKG* |
Ga0133939_10723032 | 3300010051 | Industrial Wastewater | MRAFMANILVTLFAVFLCLVNAVIWAFVSEMPLVGIAWVGAATFSYQLHKWSRN* |
Ga0134121_101604634 | 3300010401 | Terrestrial Soil | VFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG* |
Ga0150985_1162707661 | 3300012212 | Avena Fatua Rhizosphere | VTFRKCKDRGCRERIALMANIFVCLFAVTLCLLNAVIWAFMSEMLFVGLAWVGAAAFCLFLQKWSRF* |
Ga0138256_109166951 | 3300012533 | Active Sludge | MANILVTLFAVFLCLVNAVIWAFISGMPLVGIAWVGAATFSYQLHKWSRY* |
Ga0164308_113830341 | 3300012985 | Soil | MANIFVCLFAVTLCLVNAVIWAFISEMPLMGIAWVGCAGFCLF |
Ga0157374_106189592 | 3300013296 | Miscanthus Rhizosphere | FAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKY* |
Ga0157378_105576082 | 3300013297 | Miscanthus Rhizosphere | RARIALMANIFVCLFAVSLCLINAVIWAFMSEMLFVGLGWVCAATLSLFLPNWSRY* |
Ga0157375_124150162 | 3300013308 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLTNAVIWAFFSEMRIVGLCWVAGAAFCLFLQKWSRY* |
Ga0119887_10106441 | 3300013769 | Sewage Treatment Plant | MANIFVCLFAVALCLVNALIWAFISKMLLVGLCWVGAAAFCLFLQKWQKG* |
Ga0182021_109111482 | 3300014502 | Fen | MANIFVCLFAVTLCLLNAVIWAFASQMPFVGLCWVGAAAFCLFLQKWAKG* |
Ga0157379_113867432 | 3300014968 | Switchgrass Rhizosphere | CLINAVIWAFMSEMLFVGLGWVGAAAFCLFLQKWSRY* |
Ga0157376_127071292 | 3300014969 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLTNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG* |
Ga0132258_105571231 | 3300015371 | Arabidopsis Rhizosphere | IFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWAKG* |
Ga0132258_117028294 | 3300015371 | Arabidopsis Rhizosphere | MTNIFVCLFAVMLCLVNAVVWAFFSEKLFVGLGWVGAAAFCLFLQKWSRF* |
Ga0132258_126834172 | 3300015371 | Arabidopsis Rhizosphere | MANIFVCLFAVMLCLLNAVIWAFVSQMLFIGLCWVGAAALCLFLQKWSRF* |
Ga0132258_137331751 | 3300015371 | Arabidopsis Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFL* |
Ga0132255_1041982082 | 3300015374 | Arabidopsis Rhizosphere | MGNIVVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKY* |
Ga0187779_108147402 | 3300017959 | Tropical Peatland | FVCLFAVILCLINAVIWAFFSQMLFVGLGWVGAAAFCLFLQKWSRY |
Ga0184638_10520852 | 3300018052 | Groundwater Sediment | MTNILVCLFAVTLCLLNAVIWAFISQMPFVGLCWVGAAAACLALQKWAKG |
Ga0184625_104813232 | 3300018081 | Groundwater Sediment | TNILVCVFAVALCLLNAVIWAFVSEKLFIGLCWVGAAALCLVLQKWQKG |
Ga0190274_101638072 | 3300018476 | Soil | MTNILVCLFAVALCLLNAVIWAFISQMPFVGLCWVAAAAACLVLQKWAKG |
Ga0190274_107215301 | 3300018476 | Soil | ILVCLFAVTLCLLNAVIWAFFSEMIFVGLGWVAAAAFCMFLQKWSRN |
Ga0190271_109162453 | 3300018481 | Soil | MANIFVCLFAVTLCLVNAVIWAFISEMPLMGIAWVGCAGFCLFLQKWSKG |
Ga0190271_117357192 | 3300018481 | Soil | MANIFVCLFAVTLCLINAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSRY |
Ga0190271_127131881 | 3300018481 | Soil | LCLVNAVIWAFFSEMVFVGLGWVGAAAFCMFLQKWAKG |
Ga0222622_111193262 | 3300022756 | Groundwater Sediment | MTNILVCVFAVALCLLNAVIWAFISEMPFVGLCWVGAAAGCLALQKWAKG |
Ga0207656_105045281 | 3300025321 | Corn Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG |
Ga0207682_100949682 | 3300025893 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWAKG |
Ga0207642_102220402 | 3300025899 | Miscanthus Rhizosphere | VTNILVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG |
Ga0207642_109349522 | 3300025899 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMRIVGLCWVAAAAFCLFLQKWSRY |
Ga0207688_102666362 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSRF |
Ga0207681_100579543 | 3300025923 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLINAVIWAFFSEMRIVGLCWVAAAAFCLFLQKWSRY |
Ga0207650_102514021 | 3300025925 | Switchgrass Rhizosphere | CGHRLVDDHVTNILVCVFAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG |
Ga0207650_105941003 | 3300025925 | Switchgrass Rhizosphere | LCLINAVIWAFFSEMRIVGLCWVAAAAFCLFLQKWSRY |
Ga0207650_112857452 | 3300025925 | Switchgrass Rhizosphere | LFAVTLCLVNAVIWAFFSEILFVGLGWVGAAAFCMFLQKWSRF |
Ga0207659_101462522 | 3300025926 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLTNAVIWAFFSEMRIVGLCWVAAAAFCLFLQKWSRY |
Ga0207659_114124401 | 3300025926 | Miscanthus Rhizosphere | IRMANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG |
Ga0207691_114059531 | 3300025940 | Miscanthus Rhizosphere | MANIFVCLFAVTLCLINAVIWAFFSEMRIVGLCWVAAAAFCLF |
Ga0207679_110846082 | 3300025945 | Corn Rhizosphere | FAVALCLVNAVIWAFISQMPFVGLCWVGAAAACLVLQKWAKG |
Ga0207703_100929675 | 3300026035 | Switchgrass Rhizosphere | QSASRHNCIRMANIFVCLFAVTLCLLNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG |
Ga0207641_106143023 | 3300026088 | Switchgrass Rhizosphere | MANIFVCLFAVSLCLINAVIWAFFSDMRVVGLCWVGAAAFCLFLQKWSRY |
Ga0207641_109551023 | 3300026088 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLINAVIWAFMSEMPFVGLAWVG |
Ga0207648_112476651 | 3300026089 | Miscanthus Rhizosphere | VTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSRY |
Ga0207676_118726992 | 3300026095 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLINAVIWAFMSEMLFVGLGWVGAAAFCMFLQKWSRF |
Ga0207698_121873832 | 3300026142 | Corn Rhizosphere | RRVKRRRMANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSRF |
Ga0209682_100673453 | 3300027716 | Wetland Sediment | MANIFVTLFAVILCLLNAVIWAFISLMPLVGVGWVGAAAGCLWLHKWSRY |
Ga0209450_102114112 | 3300027885 | Freshwater Lake Sediment | MTNILVTLFAVTLCLLNAVIWTFISGMPLVGVCWVGAAAGSYWLHKWSRL |
Ga0209254_101074214 | 3300027897 | Freshwater Lake Sediment | MANIFVTLFAVILCLLNAVIWAFISLMPLVGVGWVAAAAGCLWLHKWSRY |
Ga0209254_105220382 | 3300027897 | Freshwater Lake Sediment | MTNILVTLFAVTLCLLNAVIWTFISGMPLVGVGWVGAAAGSYWLHKWSRF |
Ga0209668_100138359 | 3300027899 | Freshwater Lake Sediment | MANIFVTLFAVILCLINAVIWAFVSQMPLVGVGWVGAAAGCLWLHKWSRY |
Ga0209253_1000241712 | 3300027900 | Freshwater Lake Sediment | MANIFVTLFAVILCLINAVIWAFISLMPLVGLGWVAAAAGCLWLHKWSRY |
Ga0268266_119801681 | 3300028379 | Switchgrass Rhizosphere | MANIFVCLFAVMLCLVNAVIWAFISEMPLMGIAWVGCAGF |
Ga0268265_101092431 | 3300028380 | Switchgrass Rhizosphere | INAVIWAFMSEMLFVGLGWVGAAAFCLFLQKWSRF |
Ga0268265_104055821 | 3300028380 | Switchgrass Rhizosphere | MANIFVCLFAVTLCLINAVIWAFMSEMLFVGLGWV |
Ga0268264_102378602 | 3300028381 | Switchgrass Rhizosphere | MANIFVCLFAVSLCLINAVIWAFMSEMLFVGLGWVGAAAFCLFLQKWSRY |
Ga0311364_111108382 | 3300031521 | Fen | MANIFVCLFAVTLCLLNAVIWAFASQMPFVGLCWVGAAAFCLFLQKWAKG |
Ga0311364_114537541 | 3300031521 | Fen | LNAVIWAFISEMPFVGLCWVGAAALCLVLQKWAKG |
Ga0302321_1000954634 | 3300031726 | Fen | MANMLVCVFAVALCLLNAVIWAFISEMPFVGLCWVGAAALCLVLQKWAKG |
Ga0307405_100531597 | 3300031731 | Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFC |
Ga0307410_113312261 | 3300031852 | Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSQMVFVGLGWVGAAAFCMFLQKWAKG |
Ga0307412_120862702 | 3300031911 | Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSK |
Ga0311367_102346984 | 3300031918 | Fen | MANIFVTLFAVALCLVNAVVWTFISELPLMGVCWVGAAAFCLFLNKWARG |
Ga0307409_1028618511 | 3300031995 | Rhizosphere | MANIFVCLFAVTLCLVNAVIWAFFSEMVFVGLGWVG |
Ga0307416_1024501641 | 3300032002 | Rhizosphere | FVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQKWSKG |
Ga0315292_102293323 | 3300032143 | Sediment | MANIFVTLFAVTLCLLNAVIWAFISLMPFVGVGWVAAAAGCLWLHKWSRY |
Ga0315912_114916271 | 3300032157 | Soil | MANIFVCLFAVTLCLVNAVIWAFFSEMLFVGLGWVGAAAFCMFLQK |
Ga0335070_107320162 | 3300032829 | Soil | MANIFVCLFAVILCLINAVIWAFFSQMLFVGLGWVGAAAFCLFLQKWSRY |
Ga0316605_103908073 | 3300033408 | Soil | MANIFVTLFAVTLCLINAVIWAFVSGMPLVGVGWVGAAAGCLWLHKWSRF |
Ga0316625_1005930762 | 3300033418 | Soil | MANIFVTLFAVTLCLINAVIWAFVSQMPLVGVGWVGAAAGCLWLHKWSRY |
Ga0316625_1018641181 | 3300033418 | Soil | MANIFVTLFAVSLCLINAVIWAFVSGMPLVGVGWVGAAAGCLWLHKWSRF |
Ga0316627_1007613711 | 3300033482 | Soil | LCLINAVIWAFVSGMPLVGVGWVGAAAGCLWLHKWSRF |
Ga0370506_075337_3_155 | 3300034157 | Untreated Peat Soil | MANIFVTLFAVGLCLVNAVIWTFISELPLMGVCWVGAAGLCLFLHKWAKG |
Ga0364932_0218557_319_471 | 3300034177 | Sediment | MANIFVTLFAVMLCLLNAVVWTFFSEKLFMGLGWVGAAAFCLFLHKWSRY |
Ga0370485_0057881_896_1030 | 3300034358 | Untreated Peat Soil | TLFAVGLCLVNTLIWAFVSQMPLVGLCWLGAAAACLTLHKWSKG |
Ga0370485_0326134_1_147 | 3300034358 | Untreated Peat Soil | MANIFVCLFAVMLCLVNAVIWAFISEMPLMGIAWVGCAGFCLFLQKWSK |
Ga0370497_0167172_1_138 | 3300034965 | Untreated Peat Soil | MANIFVCLFAVTLCLVNAVIWAFISQMLFVGLCWVGAAAFCLVLQK |
⦗Top⦘ |