Scaffold Ga0126382_10001162

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126382_10001162

Scaffold Ga0126382_10001162

Overview

Basic Information
Taxon OID	3300010047 Open in IMG/M
Scaffold ID	Ga0126382_10001162 Open in IMG/M
Source Dataset Name	Tropical forest soil microbial communities from Panama - MetaG Plot_30
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10697
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (42.86%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location Name	Panama
Coordinates	Lat. (^o)	9.1086	Long. (^o)	-79.8436	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033981	Metagenome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126382_100011629	F033981	N/A	VDAVGENQEPDDRKKPLSAEEQKAALRRRREIFDALMKVLRGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.