Metagenome Family F033981

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F033981
Family Type	Metagenome
Number of Sequences	176
Average Sequence Length	40 residues
Representative Sequence	MGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG
Number of Associated Samples	147
Number of Associated Scaffolds	176

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	17.05 %
% of genes near scaffold ends (potentially truncated)	21.59 %
% of genes from short scaffolds (< 2000 bps)	79.55 %
Associated GOLD sequencing projects	136
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (82.955 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.046 % of family members)
Environment Ontology (ENVO)	Unclassified (27.273 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.727 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 176 Family Scaffolds
PF02073	Peptidase_M29	40.91
PF01476	LysM	29.55
PF07366	SnoaL	9.66
PF00753	Lactamase_B	5.68
PF12706	Lactamase_B_2	2.84
PF13649	Methyltransf_25	1.70
PF12850	Metallophos_2	1.14
PF07755	DUF1611	1.14
PF13378	MR_MLE_C	1.14
PF06348	DUF1059	1.14
PF08241	Methyltransf_11	0.57
PF01725	Ham1p_like	0.57
PF13691	Lactamase_B_4	0.57
PF07287	AtuA	0.57
PF14269	Arylsulfotran_2	0.57
PF12680	SnoaL_2	0.57

COG ID	Name	Functional Category	% Frequency in 176 Family Scaffolds
COG2309	Leucyl aminopeptidase (aminopeptidase T)	Amino acid transport and metabolism [E]	40.91
COG3367	Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase family	General function prediction only [R]	1.14
COG0127	Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family	Nucleotide transport and metabolism [F]	0.57

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.95 %
Unclassified	root	N/A	17.05 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.95 %
Unclassified	root	N/A	17.05 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.95 %
Unclassified	root	N/A	17.05 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	40.91 %
Unclassified	root	N/A	17.05 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.27 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.57 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.57 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	35.23 %
Unclassified	root	N/A	17.05 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	3.41 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.27 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.70 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.57 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.57 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.05 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	15.91 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	2.84 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.70 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.14 %
candidate division WOR-3	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3	0.57 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.57 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.57 %
Rubrobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.05 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	15.91 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.70 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.14 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.14 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	0.57 %
candidate division WOR-3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium	0.57 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.57 %
Rubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.05 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.91 %
Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	1.70 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.14 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.14 %
Pirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae	0.57 %
Rubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	0.57 %
Pararhodobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pararhodobacter	0.57 %
candidate division WOR-3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.05 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.91 %
Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	1.70 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.14 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.14 %
Pararhodobacter zhoushanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pararhodobacter → Pararhodobacter zhoushanensis	0.57 %
Blastopirellula	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula	0.57 %
Rubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter	0.57 %
candidate division WOR-3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.05 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.91 %
Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	1.70 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.14 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.14 %
unclassified Blastopirellula	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula	0.57 %
Pararhodobacter zhoushanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pararhodobacter → Pararhodobacter zhoushanensis	0.57 %
Rubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter	0.57 %
candidate division WOR-3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.05 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	15.91 %
Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	1.70 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.14 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	1.14 %
Blastopirellula sp.	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.	0.57 %
Pararhodobacter zhoushanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pararhodobacter → Pararhodobacter zhoushanensis	0.57 %
Rubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter	0.57 %
candidate division WOR-3 bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium	0.57 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2070309009\|GPKNP_F5JHDJD02JZP53	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	505	Open in IMG/M
2124908045\|KansclcFeb2_ConsensusfromContig294317	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	516	Open in IMG/M
3300000955\|JGI1027J12803_107647307	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	1218	Open in IMG/M
3300000956\|JGI10216J12902_100417739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1281	Open in IMG/M
3300000956\|JGI10216J12902_115747742	All Organisms → cellular organisms → Bacteria	818	Open in IMG/M
3300002568\|C688J35102_119236548	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter	659	Open in IMG/M
3300002568\|C688J35102_120905917	All Organisms → cellular organisms → Bacteria	2189	Open in IMG/M
3300002911\|JGI25390J43892_10011576	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2063	Open in IMG/M
3300004081\|Ga0063454_100548398	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300004114\|Ga0062593_100304959	All Organisms → cellular organisms → Bacteria	1360	Open in IMG/M
3300004114\|Ga0062593_103528129	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	502	Open in IMG/M
3300004156\|Ga0062589_100716357	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	891	Open in IMG/M
3300004157\|Ga0062590_100639544	All Organisms → cellular organisms → Bacteria	944	Open in IMG/M
3300004157\|Ga0062590_102413613	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	555	Open in IMG/M
3300004463\|Ga0063356_103119669	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300004643\|Ga0062591_101609126	All Organisms → cellular organisms → Bacteria	655	Open in IMG/M
3300005093\|Ga0062594_100820523	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	864	Open in IMG/M
3300005176\|Ga0066679_10225796	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1201	Open in IMG/M
3300005178\|Ga0066688_10176814	All Organisms → cellular organisms → Bacteria	1347	Open in IMG/M
3300005178\|Ga0066688_10915282	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	540	Open in IMG/M
3300005179\|Ga0066684_10215087	All Organisms → cellular organisms → Bacteria	1249	Open in IMG/M
3300005179\|Ga0066684_10821632	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300005184\|Ga0066671_10579920	Not Available	726	Open in IMG/M
3300005332\|Ga0066388_100125337	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3101	Open in IMG/M
3300005334\|Ga0068869_100280100	All Organisms → cellular organisms → Bacteria	1341	Open in IMG/M
3300005338\|Ga0068868_100384367	All Organisms → cellular organisms → Bacteria	1208	Open in IMG/M
3300005347\|Ga0070668_100369215	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300005406\|Ga0070703_10005731	All Organisms → cellular organisms → Bacteria	3478	Open in IMG/M
3300005434\|Ga0070709_10067121	All Organisms → cellular organisms → Bacteria	2303	Open in IMG/M
3300005434\|Ga0070709_10241058	All Organisms → cellular organisms → Bacteria	1298	Open in IMG/M
3300005434\|Ga0070709_11176476	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300005435\|Ga0070714_101917841	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300005436\|Ga0070713_100361047	All Organisms → cellular organisms → Bacteria	1349	Open in IMG/M
3300005437\|Ga0070710_10109861	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1655	Open in IMG/M
3300005439\|Ga0070711_100043237	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3050	Open in IMG/M
3300005445\|Ga0070708_100275848	All Organisms → cellular organisms → Bacteria	1582	Open in IMG/M
3300005445\|Ga0070708_100695042	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	957	Open in IMG/M
3300005446\|Ga0066686_10812916	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	621	Open in IMG/M
3300005454\|Ga0066687_10175464	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1152	Open in IMG/M
3300005467\|Ga0070706_100185120	All Organisms → cellular organisms → Bacteria	1946	Open in IMG/M
3300005468\|Ga0070707_100043456	All Organisms → cellular organisms → Bacteria	4301	Open in IMG/M
3300005536\|Ga0070697_100064055	All Organisms → cellular organisms → Bacteria	3002	Open in IMG/M
3300005536\|Ga0070697_100191937	All Organisms → cellular organisms → Bacteria	1734	Open in IMG/M
3300005536\|Ga0070697_100515286	Not Available	1047	Open in IMG/M
3300005540\|Ga0066697_10447291	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	744	Open in IMG/M
3300005545\|Ga0070695_100214352	All Organisms → cellular organisms → Bacteria	1384	Open in IMG/M
3300005549\|Ga0070704_100055392	All Organisms → cellular organisms → Bacteria	2811	Open in IMG/M
3300005552\|Ga0066701_10222471	All Organisms → cellular organisms → Bacteria	1162	Open in IMG/M
3300005553\|Ga0066695_10392313	Not Available	863	Open in IMG/M
3300005556\|Ga0066707_10532501	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300005559\|Ga0066700_10532869	All Organisms → cellular organisms → Bacteria	819	Open in IMG/M
3300005561\|Ga0066699_10121762	All Organisms → cellular organisms → Bacteria	1748	Open in IMG/M
3300005574\|Ga0066694_10164690	All Organisms → cellular organisms → Bacteria	1052	Open in IMG/M
3300005576\|Ga0066708_10517566	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M
3300005615\|Ga0070702_100114202	All Organisms → cellular organisms → Bacteria	1680	Open in IMG/M
3300005713\|Ga0066905_100070972	All Organisms → cellular organisms → Bacteria	2241	Open in IMG/M
3300006046\|Ga0066652_100005129	All Organisms → cellular organisms → Bacteria	7695	Open in IMG/M
3300006058\|Ga0075432_10056219	All Organisms → cellular organisms → Bacteria	1395	Open in IMG/M
3300006163\|Ga0070715_10011912	All Organisms → cellular organisms → Bacteria	3146	Open in IMG/M
3300006797\|Ga0066659_10155863	All Organisms → cellular organisms → Bacteria	1629	Open in IMG/M
3300006797\|Ga0066659_10760917	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	797	Open in IMG/M
3300006871\|Ga0075434_100050320	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4139	Open in IMG/M
3300006904\|Ga0075424_101623063	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300009012\|Ga0066710_100497589	All Organisms → cellular organisms → Bacteria	1837	Open in IMG/M
3300009147\|Ga0114129_11180209	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	954	Open in IMG/M
3300009162\|Ga0075423_10489029	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1294	Open in IMG/M
3300009176\|Ga0105242_11258464	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	762	Open in IMG/M
3300010044\|Ga0126310_10848534	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	707	Open in IMG/M
3300010047\|Ga0126382_10001162	All Organisms → cellular organisms → Bacteria	10697	Open in IMG/M
3300010333\|Ga0134080_10151930	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	982	Open in IMG/M
3300010336\|Ga0134071_10091803	All Organisms → cellular organisms → Bacteria	1434	Open in IMG/M
3300010373\|Ga0134128_12859447	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	532	Open in IMG/M
3300010399\|Ga0134127_11232028	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	816	Open in IMG/M
3300012198\|Ga0137364_10958671	Not Available	648	Open in IMG/M
3300012199\|Ga0137383_11313723	Not Available	515	Open in IMG/M
3300012200\|Ga0137382_10418923	Not Available	945	Open in IMG/M
3300012200\|Ga0137382_10611820	Not Available	778	Open in IMG/M
3300012200\|Ga0137382_11223045	Not Available	533	Open in IMG/M
3300012201\|Ga0137365_10011887	All Organisms → cellular organisms → Bacteria	6868	Open in IMG/M
3300012201\|Ga0137365_10683879	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	750	Open in IMG/M
3300012206\|Ga0137380_10098839	All Organisms → cellular organisms → Bacteria	2666	Open in IMG/M
3300012208\|Ga0137376_10079003	All Organisms → cellular organisms → Bacteria	2754	Open in IMG/M
3300012208\|Ga0137376_10357088	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1269	Open in IMG/M
3300012208\|Ga0137376_10812622	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium	804	Open in IMG/M
3300012209\|Ga0137379_10374042	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1334	Open in IMG/M
3300012211\|Ga0137377_10011162	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	7560	Open in IMG/M
3300012349\|Ga0137387_10130514	Not Available	1777	Open in IMG/M
3300012350\|Ga0137372_10029573	All Organisms → cellular organisms → Bacteria	5033	Open in IMG/M
3300012350\|Ga0137372_10147874	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1921	Open in IMG/M
3300012353\|Ga0137367_10493833	Not Available	863	Open in IMG/M
3300012354\|Ga0137366_10119362	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1992	Open in IMG/M
3300012356\|Ga0137371_11271437	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	546	Open in IMG/M
3300012361\|Ga0137360_11217483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	651	Open in IMG/M
3300012362\|Ga0137361_11238326	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	670	Open in IMG/M
3300012896\|Ga0157303_10023121	Not Available	1073	Open in IMG/M
3300012912\|Ga0157306_10213619	Not Available	657	Open in IMG/M
3300012929\|Ga0137404_10045227	All Organisms → cellular organisms → Bacteria	3344	Open in IMG/M
3300012957\|Ga0164303_10862387	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	630	Open in IMG/M
3300012958\|Ga0164299_10169312	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1230	Open in IMG/M
3300012960\|Ga0164301_10293038	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1091	Open in IMG/M
3300012976\|Ga0134076_10492443	Not Available	559	Open in IMG/M
3300012987\|Ga0164307_10599684	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	849	Open in IMG/M
3300012989\|Ga0164305_10663348	Not Available	847	Open in IMG/M
3300013296\|Ga0157374_10519803	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1196	Open in IMG/M
3300013297\|Ga0157378_10195460	All Organisms → cellular organisms → Bacteria	1910	Open in IMG/M
3300013307\|Ga0157372_11721296	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	721	Open in IMG/M
3300013308\|Ga0157375_10430822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1485	Open in IMG/M
3300013770\|Ga0120123_1135434	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300014157\|Ga0134078_10348785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	650	Open in IMG/M
3300015357\|Ga0134072_10393818	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	544	Open in IMG/M
3300018027\|Ga0184605_10024287	All Organisms → cellular organisms → Bacteria	2457	Open in IMG/M
3300018027\|Ga0184605_10074367	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1474	Open in IMG/M
3300018028\|Ga0184608_10058065	All Organisms → cellular organisms → Bacteria	1541	Open in IMG/M
3300018061\|Ga0184619_10001136	All Organisms → cellular organisms → Bacteria	9293	Open in IMG/M
3300018061\|Ga0184619_10041163	All Organisms → cellular organisms → Bacteria	1985	Open in IMG/M
3300018061\|Ga0184619_10337533	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	688	Open in IMG/M
3300018071\|Ga0184618_10334824	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	646	Open in IMG/M
3300018431\|Ga0066655_10518232	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	792	Open in IMG/M
3300018431\|Ga0066655_11001920	Not Available	577	Open in IMG/M
3300018433\|Ga0066667_10009269	All Organisms → cellular organisms → Bacteria	4626	Open in IMG/M
3300018433\|Ga0066667_10085819	Not Available	2045	Open in IMG/M
3300018433\|Ga0066667_11115061	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	683	Open in IMG/M
3300018433\|Ga0066667_11852073	Not Available	548	Open in IMG/M
3300018465\|Ga0190269_11556650	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	548	Open in IMG/M
3300018468\|Ga0066662_10314734	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1324	Open in IMG/M
3300018482\|Ga0066669_10999580	Not Available	755	Open in IMG/M
3300019361\|Ga0173482_10260393	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11	743	Open in IMG/M
3300019867\|Ga0193704_1095034	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	527	Open in IMG/M
3300019887\|Ga0193729_1002593	All Organisms → cellular organisms → Bacteria	8990	Open in IMG/M
3300019890\|Ga0193728_1005918	All Organisms → cellular organisms → Bacteria	6189	Open in IMG/M
3300021080\|Ga0210382_10363298	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.	640	Open in IMG/M
3300025885\|Ga0207653_10024747	All Organisms → cellular organisms → Bacteria	1917	Open in IMG/M
3300025898\|Ga0207692_10056586	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2012	Open in IMG/M
3300025899\|Ga0207642_10338709	Not Available	884	Open in IMG/M
3300025901\|Ga0207688_10013461	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	4445	Open in IMG/M
3300025905\|Ga0207685_10394975	Not Available	708	Open in IMG/M
3300025906\|Ga0207699_10025186	All Organisms → cellular organisms → Bacteria	3264	Open in IMG/M
3300025906\|Ga0207699_10501396	Not Available	876	Open in IMG/M
3300025910\|Ga0207684_10168578	Not Available	1887	Open in IMG/M
3300025913\|Ga0207695_11620854	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	528	Open in IMG/M
3300025923\|Ga0207681_11410422	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300025928\|Ga0207700_11669174	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	562	Open in IMG/M
3300025929\|Ga0207664_10513641	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1073	Open in IMG/M
3300025931\|Ga0207644_10705229	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	842	Open in IMG/M
3300025939\|Ga0207665_10010479	All Organisms → cellular organisms → Bacteria	6090	Open in IMG/M
3300025961\|Ga0207712_10162571	All Organisms → cellular organisms → Bacteria	1737	Open in IMG/M
3300025981\|Ga0207640_10251560	Not Available	1372	Open in IMG/M
3300026041\|Ga0207639_11915352	Not Available	554	Open in IMG/M
3300026118\|Ga0207675_100026336	All Organisms → cellular organisms → Bacteria	5413	Open in IMG/M
3300026121\|Ga0207683_10337532	Not Available	1382	Open in IMG/M
3300026295\|Ga0209234_1058185	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1470	Open in IMG/M
3300026324\|Ga0209470_1173869	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	934	Open in IMG/M
3300026343\|Ga0209159_1245862	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	545	Open in IMG/M
3300026528\|Ga0209378_1103635	Not Available	1252	Open in IMG/M
3300026530\|Ga0209807_1195416	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	717	Open in IMG/M
3300026550\|Ga0209474_10069419	All Organisms → cellular organisms → Bacteria	2453	Open in IMG/M
3300026552\|Ga0209577_10407440	Not Available	975	Open in IMG/M
3300026792\|Ga0207499_102856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pararhodobacter → Pararhodobacter zhoushanensis	586	Open in IMG/M
3300026974\|Ga0207555_100786	Not Available	652	Open in IMG/M
3300028705\|Ga0307276_10062887	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	845	Open in IMG/M
3300028718\|Ga0307307_10008638	All Organisms → cellular organisms → Bacteria	2676	Open in IMG/M
3300028768\|Ga0307280_10214938	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	683	Open in IMG/M
3300028784\|Ga0307282_10496769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	592	Open in IMG/M
3300028787\|Ga0307323_10192950	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	735	Open in IMG/M
3300028787\|Ga0307323_10235301	Not Available	660	Open in IMG/M
3300028807\|Ga0307305_10021532	All Organisms → cellular organisms → Bacteria	2903	Open in IMG/M
3300028824\|Ga0307310_10510635	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	606	Open in IMG/M
3300028881\|Ga0307277_10015397	All Organisms → cellular organisms → Bacteria	2968	Open in IMG/M
3300028881\|Ga0307277_10031676	All Organisms → cellular organisms → Bacteria	2107	Open in IMG/M
3300028881\|Ga0307277_10124343	All Organisms → cellular organisms → Bacteria	1107	Open in IMG/M
3300031562\|Ga0310886_10211884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1063	Open in IMG/M
3300031740\|Ga0307468_102285327	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	525	Open in IMG/M
3300031938\|Ga0308175_103196270	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	508	Open in IMG/M
3300032075\|Ga0310890_10228573	Not Available	1295	Open in IMG/M
3300032205\|Ga0307472_100330837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1241	Open in IMG/M
3300033475\|Ga0310811_10701166	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	979	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	86.36%
Host-Associated	Host-Associated	13.64%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.82%
Plants	Host-Associated → Plants	13.64%
Aquatic	Environmental → Aquatic	4.55%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	81.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.52%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.11%
Sediment	Environmental → Aquatic → Sediment	3.98%
Freshwater	Environmental → Aquatic → Freshwater	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.07%
Loam	Environmental → Terrestrial → Soil → Loam	18.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.82%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.98%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.70%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.57%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	31.25%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	23.30%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	15.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.82%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.98%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.70%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.70%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.14%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.57%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	17.05%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	14.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.64%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	12.50%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	6.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	5.11%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.98%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.84%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.70%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.70%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.70%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.14%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.14%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.14%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.14%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.14%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.57%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.57%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.57%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.57%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.57%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.57%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.57%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2070309009	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013770	Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M	Environmental	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019867	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026792	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3-12 (SPAdes)	Environmental	Open in IMG/M
3300026974	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-E (SPAdes)	Environmental	Open in IMG/M
3300028705	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115	Environmental	Open in IMG/M
3300028718	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPKNP_07075040	2070309009	Soil	MGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG
KansclcFeb2_04087270	2124908045	Soil	MSKKREPGECEKALSAAERKAALRRRREILDALMKILRGG
JGI1027J12803_1076473073	3300000955	Soil	MGGKRDSDDREKPLTATERKAALRRRREILDALMRVLRGS*
JGI10216J12902_1004177391	3300000956	Soil	MSKKREPGECEKALSAAERKAALRRRREILDALMKILRGG*
JGI10216J12902_1157477421	3300000956	Soil	MAGKREPDDREKALRAKERKAALRRRREIFDALMKVLRGE*
C688J35102_1192365482	3300002568	Soil	VGDKGEQDGSAKTLSAKERKAALRRRREILDALLKVLRGH*
C688J35102_1209059174	3300002568	Soil	MGGKRDHERQEASKAKARKAALRRRREILDALLKVLRAP*
JGI25390J43892_100115762	3300002911	Grasslands Soil	MGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG*
Ga0063454_1005483982	3300004081	Soil	MGEKDEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG*
Ga0062593_1003049593	3300004114	Soil	MGEKREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG*
Ga0062593_1035281291	3300004114	Soil	MVGKRDSDVREKPLTATERKAALRRRREILDALMKVLRGS*
Ga0062589_1007163572	3300004156	Soil	MGEKREPDDREKALSAEERKAAALRRRREIYEALMKVLRGC*
Ga0062590_1006395442	3300004157	Soil	MGEKREPDDREKALSAHERKAAALRRRREIYDALMKVLRGG*
Ga0062590_1024136132	3300004157	Soil	MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLRGG*
Ga0063356_1031196693	3300004463	Arabidopsis Thaliana Rhizosphere	MGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG*
Ga0062591_1016091261	3300004643	Soil	SPASVDAMGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG*
Ga0062594_1008205231	3300005093	Soil	MSGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGS*
Ga0066679_102257962	3300005176	Soil	MGEKHEPADQEKVVSANEQKAALRRRRQIFDALMKVLRGG*
Ga0066688_101768143	3300005178	Soil	MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVLRGG*
Ga0066688_109152822	3300005178	Soil	MGEKRDSDDREKPLSAKERKAALRRRREILDALLKVLRGS*
Ga0066684_102150872	3300005179	Soil	MGRKREPDDREKVLSAKEQKAALRRRREILDALMKVLRGS*
Ga0066684_108216323	3300005179	Soil	ASHASFDAMGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG*
Ga0066671_105799201	3300005184	Soil	MGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG*
Ga0066388_1001253376	3300005332	Tropical Forest Soil	DAVGEKREPDDRKKPPSAKEQKAALRRRREIFDALMKVLRGG*
Ga0068869_1002801003	3300005334	Miscanthus Rhizosphere	MGGKRESDDREKALRAEEQRAALRRRREIFDALMKVLRGG*
Ga0068868_1003843673	3300005338	Miscanthus Rhizosphere	MGGKRDADDREKALRAEELKAALRRRREIFDALMKVLRGG*
Ga0070668_1003692153	3300005347	Switchgrass Rhizosphere	MGGKREPDDREKALRAEEQKVALRRRREIFDALMKVLRGG*
Ga0070703_100057316	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	MGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG*
Ga0070709_100671213	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDRKNPLTATERKVALRRRREILDALMKVLRGS*
Ga0070709_102410583	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MGENREPDDREKALSAEERKTAALRRRREIYDALMKALRGG*
Ga0070709_111764762	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MGVKREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG*
Ga0070714_1019178411	3300005435	Agricultural Soil	AMGGKREPDDREKALRAKERKAALRRRREIFDALMKVLRGA*
Ga0070713_1003610472	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGS*
Ga0070710_101098613	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDREKPLTATERKVALRRRREILDALMKVLRGS*
Ga0070711_1000432374	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRESDDREKPLRAEEQKAALRRRREIFDALMKVLRGG*
Ga0070708_1002758482	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MGKREPDDRKKALSAEERKAALRRRREIYDALMKVLRGG*
Ga0070708_1006950421	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKREPDDREKALRAKERKAALRRRREIFDALMKVLRGA*
Ga0066686_108129162	3300005446	Soil	MGGKRESDDREKPLSAKERKAALRRRREILDALLKALRGY*
Ga0066687_101754642	3300005454	Soil	MGEKHEPADQEKVMSANEQKAALRRRRQIFDALMKVLRGG*
Ga0070706_1001851203	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MAGKRDLDDREKPLTATERKAALRRRREILDALMKVLRGS*
Ga0070707_1000434564	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRESDDRVKALRAKERKAALRRRREILDALMKVLRGG*
Ga0070697_1000640552	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MGVKREPDDREKALSAEERKAAALRRRREIYDALMKALRGG*
Ga0070697_1001919373	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGP*
Ga0070697_1005152863	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRESDDRAKALKAKERKAALRRRREILDALMKVLRGG*
Ga0066697_104472912	3300005540	Soil	MGEKREDDREKALRAEQRKAALRRRREIFDALMKALRGG*
Ga0070695_1002143522	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDREKPLTATERKAALRRRREILDALIKVLRGP*
Ga0070704_1000553922	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDPDDREKALRTEELKAALRRRREIFDALMKVLRGG*
Ga0066701_102224713	3300005552	Soil	MGGKREPDDREKTQRAKEREAALRRRREIFDALMKVLRGG*
Ga0066695_103923132	3300005553	Soil	MGEKREDDREKALRAEERNAALRRRREIFDALMKVLRGG*
Ga0066707_105325013	3300005556	Soil	MGEKREQTDRERPLSAKQRKAALRRRQEIFDALMKVLRGG*
Ga0066700_105328692	3300005559	Soil	MGGKREPDDREKALRAKERKAALRRRREIFDALMKALRGA*
Ga0066699_101217622	3300005561	Soil	MGEKHEPADQEKVMSSNEQKAALRRRRQIFDALMKVLRGG*
Ga0066694_101646902	3300005574	Soil	MGEKREDDRKKALRAEERKAALRRRREIFDALMKVLRGG*
Ga0066708_105175661	3300005576	Soil	GEKHEPADQEKVMSANEQKAALRRRRQIFDALMKVLRGG*
Ga0070702_1001142024	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MGEKREPDDREKALSAEERKAAALRRRREIYDALMKVLRG*
Ga0066905_1000709722	3300005713	Tropical Forest Soil	VDAVGEKREPEDRKKPLSAREQKAALRRRREIFDALMKVLRGG*
Ga0066652_1000051293	3300006046	Soil	VGGKRERDESPKPLSAKERKAALRRRREILDALLKVLRGY*
Ga0075432_100562192	3300006058	Populus Rhizosphere	MGEKREPDDREKALSAKERKAAALRRRREIYDALMKVLRGG*
Ga0070715_100119122	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDRKNPLTATGRKVALRRRREILDALMKVLRGS*
Ga0066659_101558634	3300006797	Soil	MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVLRGA*
Ga0066659_107609172	3300006797	Soil	MGGKRDSDHREKPLSAKERKAALRRRREILDALLKVLRGS*
Ga0075434_1000503201	3300006871	Populus Rhizosphere	MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLR
Ga0075424_1016230633	3300006904	Populus Rhizosphere	REPDDREKALSAEERKAAALRRRREIYDALMKVLRGG*
Ga0066710_1004975891	3300009012	Grasslands Soil	VGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG
Ga0114129_111802092	3300009147	Populus Rhizosphere	MGEKREPDDREKAPSAKERKAAALRRRREIYDALMKVLRGG*
Ga0075423_104890292	3300009162	Populus Rhizosphere	MGGKREPDKEEKPMSAKERKAALRRRLEIFDALMKVLRGG*
Ga0105242_112584642	3300009176	Miscanthus Rhizosphere	MGENREPDDREKALSAEERKTAALRRRREIYDALMK
Ga0126310_108485342	3300010044	Serpentine Soil	VGDKGEQDESAKTLSAKERKAAVRRRREILDALLKVLRGY*
Ga0126382_100011629	3300010047	Tropical Forest Soil	VDAVGENQEPDDRKKPLSAEEQKAALRRRREIFDALMKVLRGG*
Ga0134080_101519302	3300010333	Grasslands Soil	MGEKREDDREKALRAEERKAVLRRRREIFDALMKVLRGG*
Ga0134071_100918032	3300010336	Grasslands Soil	MGEKREDDREKALRAEERKAALRRRREIFDALMKALRGG*
Ga0134128_128594472	3300010373	Terrestrial Soil	MGGKRESDDREKALRAEEKRAALRRRREIFDALMKVLRGG*
Ga0134127_112320281	3300010399	Terrestrial Soil	MGEKREPDDREKAPSAEERKAAALRRRREIYDALMKVL
Ga0137364_109586712	3300012198	Vadose Zone Soil	MGEKREDDREKTLRAEQRKAALRRRREIFDALMKMLRGG*
Ga0137383_113137232	3300012199	Vadose Zone Soil	MGGKRDSDDREKPLSAKERKAALRRRREILDALLKVLRGS*
Ga0137382_104189233	3300012200	Vadose Zone Soil	MGEKNEPADQEKVMSANEQKAALRRRRQILDALMKVLRGG*
Ga0137382_106118202	3300012200	Vadose Zone Soil	MGGKRNSDHREKPLSAKERKAALRRRREILDALLKVLRGS*
Ga0137382_112230451	3300012200	Vadose Zone Soil	MDGKREPDDCKKPLTAKERKAALRRRREILDALLKALRGE*
Ga0137365_100118875	3300012201	Vadose Zone Soil	MGGKRDSDDREKPLSAKEGKAALRRRREILDALLKVLRGS*
Ga0137365_106838792	3300012201	Vadose Zone Soil	MGGKREPDEQGKPLTEEERKAALRRRREILDALLKALRGS*
Ga0137380_100988392	3300012206	Vadose Zone Soil	MGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGGYP*
Ga0137376_100790031	3300012208	Vadose Zone Soil	HASFDALGEKHEPADQEKVVSANVQKAALRRRRQIFNALMKVLRGG*
Ga0137376_103570882	3300012208	Vadose Zone Soil	MGEKHEPGDQEKVVSANERKAALRRRRQIFDVLMKVLRGG*
Ga0137376_108126222	3300012208	Vadose Zone Soil	MGEKREQADRERPLSAKQRKAALRRRREIFDALMKVLRGG*
Ga0137379_103740422	3300012209	Vadose Zone Soil	MGEKREDDREKALRAEERKAVLRRRREIFDALMKVLRGGYP*
Ga0137377_100111625	3300012211	Vadose Zone Soil	MGGKREPNDREKALRAKERKAALRRRREIFDALMKALRGG*
Ga0137387_101305141	3300012349	Vadose Zone Soil	KREDDREKALRAEERKAVLRRRREIFDALMKVLRGG*
Ga0137372_100295735	3300012350	Vadose Zone Soil	MSGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGGYP*
Ga0137372_101478742	3300012350	Vadose Zone Soil	MDGKHEPAERKKPLTAKERKAALRRRREILDALLKALRGY*
Ga0137367_104938332	3300012353	Vadose Zone Soil	MGGKSEPDDREKALRAEEQKAALRRRREIFDALMKVLRGGYP*
Ga0137366_101193622	3300012354	Vadose Zone Soil	MDGKHEPAERKKSLTAKERKAALRRRREILDALLKALRGY*
Ga0137371_112714373	3300012356	Vadose Zone Soil	GKRESDDREKPLSAKERKAALRRRREILDALLKALRGY*
Ga0137360_112174832	3300012361	Vadose Zone Soil	MGAKREPDDREKALGAKERKAALRRRREIFDALMKVLRGG*
Ga0137361_112383263	3300012362	Vadose Zone Soil	MGGKRDSDDGEKPLSAKERKAALRRRREILDALLKVLRGS*
Ga0157303_100231211	3300012896	Soil	EPDDREKALSAEERKAAALRRRREIYEALMKVLRGC*
Ga0157306_102136192	3300012912	Soil	MGGKREPDDREKAVRAEEQKAALRRRREIFDALMKVLRGG*
Ga0137404_100452277	3300012929	Vadose Zone Soil	SPASVDPMGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG*
Ga0164303_108623873	3300012957	Soil	MGGKHESNDREKPLSAKERKAALRRRREILDALLKVLRGS*
Ga0164299_101693124	3300012958	Soil	VDAMGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG*
Ga0164301_102930384	3300012960	Soil	GAMGGKHESNDREKPLSAKERKAALRRRREILDALLKVLRGS*
Ga0134076_104924432	3300012976	Grasslands Soil	MGEKREDDREKALRAEERKAALRRRRDIFDALMKVLRGG*
Ga0164307_105996843	3300012987	Soil	ALASLDAMGGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGS*
Ga0164305_106633482	3300012989	Soil	MGGKRDSDDREKPLTATERKAALRRRREILDALMKALRGS*
Ga0157374_105198031	3300013296	Miscanthus Rhizosphere	SVDAMGGKRESDDREKALRAEEQRAALRRRREIFDALMKVLRGG*
Ga0157378_101954604	3300013297	Miscanthus Rhizosphere	MGEKREPDDREKALSAEERKTAALRRRREIYDALMKALRGG*
Ga0157372_117212962	3300013307	Corn Rhizosphere	MGGKREPDDREKDLRAEEQKVALRRRREIFDALMKVLRGG*
Ga0157375_104308223	3300013308	Miscanthus Rhizosphere	MGGKREPDDREKALRAEEQRAALRRRREIFDALMKVLRGG*
Ga0120123_11354342	3300013770	Permafrost	MGGKREHHDREKALSAKDDKAALRRRREILSALMKVLRGS*
Ga0134078_103487852	3300014157	Grasslands Soil	MGEKREHDREKAPRAKERKAALRRRREIFDALMKVLRGG*
Ga0134072_103938181	3300015357	Grasslands Soil	VDAMGRKREPDDREKVLSAKEQKAALRRRREILDALMKVLRGS*
Ga0184605_100242874	3300018027	Groundwater Sediment	MDGKRESDERKKTLTVKERKAALRRRREILDALLKALRGY
Ga0184605_100743672	3300018027	Groundwater Sediment	MGGKRESDDREKALRAEEQKAALRRRREIFDALMKVLRGG
Ga0184608_100580654	3300018028	Groundwater Sediment	MGEKREDDREKASRAKERKAALRRRREIFDALMKVLRGG
Ga0184619_100011364	3300018061	Groundwater Sediment	MDGKRESDERKKTLTAKERKAALRRRREILDALLKALRGY
Ga0184619_100411632	3300018061	Groundwater Sediment	MGGKREHDDREKALRAKDDKAALRRRREILSALMKVLRGS
Ga0184619_103375331	3300018061	Groundwater Sediment	MGGKREPDDQEKALRAEEQKAALRRRREIFDALMK
Ga0184618_103348242	3300018071	Groundwater Sediment	MGGKRESDDREKALRAEEQKAALRRRRELFDALMKVLRGG
Ga0066655_105182321	3300018431	Grasslands Soil	MGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG
Ga0066655_110019202	3300018431	Grasslands Soil	MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVL
Ga0066667_100092695	3300018433	Grasslands Soil	MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVLRGG
Ga0066667_100858191	3300018433	Grasslands Soil	MGEKHEPADQEKVMSANEQKAALRRRRQIFDALMKVLRGG
Ga0066667_111150611	3300018433	Grasslands Soil	MGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG
Ga0066667_118520731	3300018433	Grasslands Soil	MGGKREPDDREKTQRAKEREAALRRRREIFDALMKVLRGG
Ga0190269_115566503	3300018465	Soil	MGGKREPDDREKALRAEEQKAALRRRREILDALMKVLRGG
Ga0066662_103147342	3300018468	Grasslands Soil	MGGKRGSDHREKPLSAKERKAALRRRREILDALLKVLRGS
Ga0066669_109995803	3300018482	Grasslands Soil	MGEKREHDREKASRAKERKAALRRRREIFDALMKVLRGG
Ga0173482_102603932	3300019361	Soil	MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLRGG
Ga0193704_10950342	3300019867	Soil	MGGKRESDDREKALRAEKQKAALRRRREIFDALMKVLRGG
Ga0193729_10025933	3300019887	Soil	MGGKRDSDDREKRLSAKERKAALRRRREILDALLKVLRGS
Ga0193728_10059183	3300019890	Soil	MGGKREHDDREKAPSAKDDKAALRRRREILSALMKVLRGS
Ga0210382_103632982	3300021080	Groundwater Sediment	MGGKREPDDQEKALRAEEQKAALRRRREIFDALMKVLRGG
Ga0207653_100247472	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG
Ga0207692_100565863	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDREKPLTATERKVALRRRREILDALMKVLRGS
Ga0207642_103387091	3300025899	Miscanthus Rhizosphere	GKRESDDREKPLRAEEQKAALRRRREIFDALMKVLRGG
Ga0207688_100134613	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKREPDDREKALRAEEQKVALRRRREIFDALMKVLRGG
Ga0207685_103949751	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	EPDDREKALSAEERMAAALRRRREIYDALMKVLRGG
Ga0207699_100251863	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDRKNPLTATERKVALRRRREILDALMKVLRGS
Ga0207699_105013962	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MGEKREPDDREKALSAHERKAAALRRRREIYDALMKVLRGG
Ga0207684_101685784	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	DAMGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRG
Ga0207695_116208542	3300025913	Corn Rhizosphere	MGGKREPDDREKALRAEEQKAALRRRREIFDALMK
Ga0207681_114104222	3300025923	Switchgrass Rhizosphere	MGGKRESDDREKALRAEEQRAALRRRREIFDALMKVLRGG
Ga0207700_116691742	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDRKNPLTATERKAALRRRREILDALMKVLRGS
Ga0207664_105136412	3300025929	Agricultural Soil	MGGKRDSDDREKPLTATERKAALRRRREILDALIKVLRGP
Ga0207644_107052292	3300025931	Switchgrass Rhizosphere	MGENREPDDREKALSAEERKAAALRRRREIYDALMKALRGG
Ga0207665_100104799	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MGGKRDSDDREKPLTATETERKAALRRRREILDALMKVLRGS
Ga0207712_101625711	3300025961	Switchgrass Rhizosphere	MGGKREPDDREKALRAEEQKVALRRRREIFDALMK
Ga0207640_102515601	3300025981	Corn Rhizosphere	HPASVDAMGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG
Ga0207639_119153521	3300026041	Corn Rhizosphere	MGGKREPDDREKALRAEEQKVALRRRREIFDALMKVLR
Ga0207675_1000263363	3300026118	Switchgrass Rhizosphere	MGGKREPDDREKALRAEEQRAALRRRREIFDALMKVLRGG
Ga0207683_103375324	3300026121	Miscanthus Rhizosphere	MGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRG
Ga0209234_10581853	3300026295	Grasslands Soil	MGEKHEPADQEKVVSANEQKAALRRRRQIFDALMKVLRGG
Ga0209470_11738691	3300026324	Soil	MGEKREDDREKALRAEERKAALRRRRDIFDALMKVLRGG
Ga0209159_12458622	3300026343	Soil	MGEKREDDREKALRAEERNAALRRRREIFDALMKVLRGG
Ga0209378_11036352	3300026528	Soil	MGEKREDDRKKALRAEERKAALRRRREIFDALMKALRGG
Ga0209807_11954162	3300026530	Soil	SFDAMGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG
Ga0209474_100694194	3300026550	Soil	MGRKREPDDREKVLSAKEQKAALRRRREILDALMKVLRGS
Ga0209577_104074402	3300026552	Soil	MGRKREPDDREKVLSAKALRRRREILDALMKVLRGS
Ga0207499_1028562	3300026792	Soil	MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLRG
Ga0207555_1007862	3300026974	Soil	MGGKREPDDREKAVRAEEQKAALRRRREIFDALMKVLRGG
Ga0307276_100628871	3300028705	Soil	MDGKREPDERKKPLTGKERKAALRRRREILDALLKALRGY
Ga0307307_100086382	3300028718	Soil	MDGKRERDERQKPLTAKERKAALRRRREILDAVLKALRGY
Ga0307280_102149382	3300028768	Soil	MGGKREHDDREKAPSAKDDKPALRRRREILSALMKVLRGS
Ga0307282_104967691	3300028784	Soil	EPDERKKPLTGKERKAALRRRREILDALLKALRGY
Ga0307323_101929501	3300028787	Soil	MGEKREDDREKASRAKERKAALRRRREIFDALMKVLRGVR
Ga0307323_102353013	3300028787	Soil	VEAMGEKREDDREKASRAKERKAALRRRREIFDALMKVLRGG
Ga0307305_100215326	3300028807	Soil	KREDDREKASRAKERKAALRRRREIFDALMKVLRGG
Ga0307310_105106352	3300028824	Soil	MGGKREHDDQEKALRVKDDKAALRRRREILSALMKVLRGS
Ga0307277_100153976	3300028881	Soil	VGDKGEQDESAKTLSAKKRKAALRRRREVLDALLKVLRGQ
Ga0307277_100316762	3300028881	Soil	VDDKREPDERKKPLTAKEQKAALRRRREVLDALLKALRGH
Ga0307277_101243433	3300028881	Soil	VGCKREQDESAKSLSAKERRAALRRRREILDALLK
Ga0310886_102118842	3300031562	Soil	MGENRKPDDREKALSAEERKAAALRRRREIYDALMKVLRGG
Ga0307468_1022853271	3300031740	Hardwood Forest Soil	GGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG
Ga0308175_1031962702	3300031938	Soil	VGEKREPAECRKALTAKEQKAALRRRRELLDTLMKVLRGG
Ga0310890_102285731	3300032075	Soil	ASVDAMGENREPDDREKALSAEERKAAALRRRREIYDALMKVFRGG
Ga0307472_1003308374	3300032205	Hardwood Forest Soil	MGGKRDLDDREKPLTASERKAALRRRREILDALMKVLRGS
Ga0310811_107011662	3300033475	Soil	MGEKREPDDREKALSAEERKAAALRRRREIYEALMKVLRGG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F033981

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences