| Basic Information | |
|---|---|
| Family ID | F033981 |
| Family Type | Metagenome |
| Number of Sequences | 176 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.05 % |
| % of genes near scaffold ends (potentially truncated) | 21.59 % |
| % of genes from short scaffolds (< 2000 bps) | 79.55 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.955 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.046 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF02073 | Peptidase_M29 | 40.91 |
| PF01476 | LysM | 29.55 |
| PF07366 | SnoaL | 9.66 |
| PF00753 | Lactamase_B | 5.68 |
| PF12706 | Lactamase_B_2 | 2.84 |
| PF13649 | Methyltransf_25 | 1.70 |
| PF12850 | Metallophos_2 | 1.14 |
| PF07755 | DUF1611 | 1.14 |
| PF13378 | MR_MLE_C | 1.14 |
| PF06348 | DUF1059 | 1.14 |
| PF08241 | Methyltransf_11 | 0.57 |
| PF01725 | Ham1p_like | 0.57 |
| PF13691 | Lactamase_B_4 | 0.57 |
| PF07287 | AtuA | 0.57 |
| PF14269 | Arylsulfotran_2 | 0.57 |
| PF12680 | SnoaL_2 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 40.91 |
| COG3367 | Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase family | General function prediction only [R] | 1.14 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.95 % |
| Unclassified | root | N/A | 17.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_F5JHDJD02JZP53 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig294317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300000955|JGI1027J12803_107647307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1218 | Open in IMG/M |
| 3300000956|JGI10216J12902_100417739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
| 3300000956|JGI10216J12902_115747742 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300002568|C688J35102_119236548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter | 659 | Open in IMG/M |
| 3300002568|C688J35102_120905917 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300002911|JGI25390J43892_10011576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2063 | Open in IMG/M |
| 3300004081|Ga0063454_100548398 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300004114|Ga0062593_100304959 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300004114|Ga0062593_103528129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 | 502 | Open in IMG/M |
| 3300004156|Ga0062589_100716357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 891 | Open in IMG/M |
| 3300004157|Ga0062590_100639544 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300004157|Ga0062590_102413613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300004463|Ga0063356_103119669 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300004643|Ga0062591_101609126 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005093|Ga0062594_100820523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300005176|Ga0066679_10225796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1201 | Open in IMG/M |
| 3300005178|Ga0066688_10176814 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300005178|Ga0066688_10915282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300005179|Ga0066684_10215087 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300005179|Ga0066684_10821632 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005184|Ga0066671_10579920 | Not Available | 726 | Open in IMG/M |
| 3300005332|Ga0066388_100125337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3101 | Open in IMG/M |
| 3300005334|Ga0068869_100280100 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300005338|Ga0068868_100384367 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005347|Ga0070668_100369215 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005406|Ga0070703_10005731 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
| 3300005434|Ga0070709_10067121 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300005434|Ga0070709_10241058 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300005434|Ga0070709_11176476 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005435|Ga0070714_101917841 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005436|Ga0070713_100361047 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300005437|Ga0070710_10109861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1655 | Open in IMG/M |
| 3300005439|Ga0070711_100043237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3050 | Open in IMG/M |
| 3300005445|Ga0070708_100275848 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300005445|Ga0070708_100695042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300005446|Ga0066686_10812916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 | 621 | Open in IMG/M |
| 3300005454|Ga0066687_10175464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1152 | Open in IMG/M |
| 3300005467|Ga0070706_100185120 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300005468|Ga0070707_100043456 | All Organisms → cellular organisms → Bacteria | 4301 | Open in IMG/M |
| 3300005536|Ga0070697_100064055 | All Organisms → cellular organisms → Bacteria | 3002 | Open in IMG/M |
| 3300005536|Ga0070697_100191937 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300005536|Ga0070697_100515286 | Not Available | 1047 | Open in IMG/M |
| 3300005540|Ga0066697_10447291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 744 | Open in IMG/M |
| 3300005545|Ga0070695_100214352 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300005549|Ga0070704_100055392 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
| 3300005552|Ga0066701_10222471 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300005553|Ga0066695_10392313 | Not Available | 863 | Open in IMG/M |
| 3300005556|Ga0066707_10532501 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005559|Ga0066700_10532869 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005561|Ga0066699_10121762 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300005574|Ga0066694_10164690 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300005576|Ga0066708_10517566 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005615|Ga0070702_100114202 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300005713|Ga0066905_100070972 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300006046|Ga0066652_100005129 | All Organisms → cellular organisms → Bacteria | 7695 | Open in IMG/M |
| 3300006058|Ga0075432_10056219 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300006163|Ga0070715_10011912 | All Organisms → cellular organisms → Bacteria | 3146 | Open in IMG/M |
| 3300006797|Ga0066659_10155863 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300006797|Ga0066659_10760917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 797 | Open in IMG/M |
| 3300006871|Ga0075434_100050320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4139 | Open in IMG/M |
| 3300006904|Ga0075424_101623063 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009012|Ga0066710_100497589 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300009147|Ga0114129_11180209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300009162|Ga0075423_10489029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
| 3300009176|Ga0105242_11258464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300010044|Ga0126310_10848534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300010047|Ga0126382_10001162 | All Organisms → cellular organisms → Bacteria | 10697 | Open in IMG/M |
| 3300010333|Ga0134080_10151930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
| 3300010336|Ga0134071_10091803 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300010373|Ga0134128_12859447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300010399|Ga0134127_11232028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 816 | Open in IMG/M |
| 3300012198|Ga0137364_10958671 | Not Available | 648 | Open in IMG/M |
| 3300012199|Ga0137383_11313723 | Not Available | 515 | Open in IMG/M |
| 3300012200|Ga0137382_10418923 | Not Available | 945 | Open in IMG/M |
| 3300012200|Ga0137382_10611820 | Not Available | 778 | Open in IMG/M |
| 3300012200|Ga0137382_11223045 | Not Available | 533 | Open in IMG/M |
| 3300012201|Ga0137365_10011887 | All Organisms → cellular organisms → Bacteria | 6868 | Open in IMG/M |
| 3300012201|Ga0137365_10683879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300012206|Ga0137380_10098839 | All Organisms → cellular organisms → Bacteria | 2666 | Open in IMG/M |
| 3300012208|Ga0137376_10079003 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
| 3300012208|Ga0137376_10357088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1269 | Open in IMG/M |
| 3300012208|Ga0137376_10812622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium | 804 | Open in IMG/M |
| 3300012209|Ga0137379_10374042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
| 3300012211|Ga0137377_10011162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia | 7560 | Open in IMG/M |
| 3300012349|Ga0137387_10130514 | Not Available | 1777 | Open in IMG/M |
| 3300012350|Ga0137372_10029573 | All Organisms → cellular organisms → Bacteria | 5033 | Open in IMG/M |
| 3300012350|Ga0137372_10147874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1921 | Open in IMG/M |
| 3300012353|Ga0137367_10493833 | Not Available | 863 | Open in IMG/M |
| 3300012354|Ga0137366_10119362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1992 | Open in IMG/M |
| 3300012356|Ga0137371_11271437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300012361|Ga0137360_11217483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300012362|Ga0137361_11238326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
| 3300012896|Ga0157303_10023121 | Not Available | 1073 | Open in IMG/M |
| 3300012912|Ga0157306_10213619 | Not Available | 657 | Open in IMG/M |
| 3300012929|Ga0137404_10045227 | All Organisms → cellular organisms → Bacteria | 3344 | Open in IMG/M |
| 3300012957|Ga0164303_10862387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300012958|Ga0164299_10169312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300012960|Ga0164301_10293038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1091 | Open in IMG/M |
| 3300012976|Ga0134076_10492443 | Not Available | 559 | Open in IMG/M |
| 3300012987|Ga0164307_10599684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 849 | Open in IMG/M |
| 3300012989|Ga0164305_10663348 | Not Available | 847 | Open in IMG/M |
| 3300013296|Ga0157374_10519803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
| 3300013297|Ga0157378_10195460 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300013307|Ga0157372_11721296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300013308|Ga0157375_10430822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1485 | Open in IMG/M |
| 3300013770|Ga0120123_1135434 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300014157|Ga0134078_10348785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 650 | Open in IMG/M |
| 3300015357|Ga0134072_10393818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300018027|Ga0184605_10024287 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
| 3300018027|Ga0184605_10074367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
| 3300018028|Ga0184608_10058065 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300018061|Ga0184619_10001136 | All Organisms → cellular organisms → Bacteria | 9293 | Open in IMG/M |
| 3300018061|Ga0184619_10041163 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300018061|Ga0184619_10337533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300018071|Ga0184618_10334824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300018431|Ga0066655_10518232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300018431|Ga0066655_11001920 | Not Available | 577 | Open in IMG/M |
| 3300018433|Ga0066667_10009269 | All Organisms → cellular organisms → Bacteria | 4626 | Open in IMG/M |
| 3300018433|Ga0066667_10085819 | Not Available | 2045 | Open in IMG/M |
| 3300018433|Ga0066667_11115061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300018433|Ga0066667_11852073 | Not Available | 548 | Open in IMG/M |
| 3300018465|Ga0190269_11556650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300018468|Ga0066662_10314734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1324 | Open in IMG/M |
| 3300018482|Ga0066669_10999580 | Not Available | 755 | Open in IMG/M |
| 3300019361|Ga0173482_10260393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 | 743 | Open in IMG/M |
| 3300019867|Ga0193704_1095034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300019887|Ga0193729_1002593 | All Organisms → cellular organisms → Bacteria | 8990 | Open in IMG/M |
| 3300019890|Ga0193728_1005918 | All Organisms → cellular organisms → Bacteria | 6189 | Open in IMG/M |
| 3300021080|Ga0210382_10363298 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 640 | Open in IMG/M |
| 3300025885|Ga0207653_10024747 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300025898|Ga0207692_10056586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2012 | Open in IMG/M |
| 3300025899|Ga0207642_10338709 | Not Available | 884 | Open in IMG/M |
| 3300025901|Ga0207688_10013461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia | 4445 | Open in IMG/M |
| 3300025905|Ga0207685_10394975 | Not Available | 708 | Open in IMG/M |
| 3300025906|Ga0207699_10025186 | All Organisms → cellular organisms → Bacteria | 3264 | Open in IMG/M |
| 3300025906|Ga0207699_10501396 | Not Available | 876 | Open in IMG/M |
| 3300025910|Ga0207684_10168578 | Not Available | 1887 | Open in IMG/M |
| 3300025913|Ga0207695_11620854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300025923|Ga0207681_11410422 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300025928|Ga0207700_11669174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300025929|Ga0207664_10513641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
| 3300025931|Ga0207644_10705229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300025939|Ga0207665_10010479 | All Organisms → cellular organisms → Bacteria | 6090 | Open in IMG/M |
| 3300025961|Ga0207712_10162571 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300025981|Ga0207640_10251560 | Not Available | 1372 | Open in IMG/M |
| 3300026041|Ga0207639_11915352 | Not Available | 554 | Open in IMG/M |
| 3300026118|Ga0207675_100026336 | All Organisms → cellular organisms → Bacteria | 5413 | Open in IMG/M |
| 3300026121|Ga0207683_10337532 | Not Available | 1382 | Open in IMG/M |
| 3300026295|Ga0209234_1058185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1470 | Open in IMG/M |
| 3300026324|Ga0209470_1173869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300026343|Ga0209159_1245862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300026528|Ga0209378_1103635 | Not Available | 1252 | Open in IMG/M |
| 3300026530|Ga0209807_1195416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300026550|Ga0209474_10069419 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300026552|Ga0209577_10407440 | Not Available | 975 | Open in IMG/M |
| 3300026792|Ga0207499_102856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pararhodobacter → Pararhodobacter zhoushanensis | 586 | Open in IMG/M |
| 3300026974|Ga0207555_100786 | Not Available | 652 | Open in IMG/M |
| 3300028705|Ga0307276_10062887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300028718|Ga0307307_10008638 | All Organisms → cellular organisms → Bacteria | 2676 | Open in IMG/M |
| 3300028768|Ga0307280_10214938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 683 | Open in IMG/M |
| 3300028784|Ga0307282_10496769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300028787|Ga0307323_10192950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300028787|Ga0307323_10235301 | Not Available | 660 | Open in IMG/M |
| 3300028807|Ga0307305_10021532 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
| 3300028824|Ga0307310_10510635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300028881|Ga0307277_10015397 | All Organisms → cellular organisms → Bacteria | 2968 | Open in IMG/M |
| 3300028881|Ga0307277_10031676 | All Organisms → cellular organisms → Bacteria | 2107 | Open in IMG/M |
| 3300028881|Ga0307277_10124343 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300031562|Ga0310886_10211884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1063 | Open in IMG/M |
| 3300031740|Ga0307468_102285327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300031938|Ga0308175_103196270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300032075|Ga0310890_10228573 | Not Available | 1295 | Open in IMG/M |
| 3300032205|Ga0307472_100330837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1241 | Open in IMG/M |
| 3300033475|Ga0310811_10701166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.11% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.14% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.57% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.57% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026792 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026974 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-E (SPAdes) | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_07075040 | 2070309009 | Soil | MGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG |
| KansclcFeb2_04087270 | 2124908045 | Soil | MSKKREPGECEKALSAAERKAALRRRREILDALMKILRGG |
| JGI1027J12803_1076473073 | 3300000955 | Soil | MGGKRDSDDREKPLTATERKAALRRRREILDALMRVLRGS* |
| JGI10216J12902_1004177391 | 3300000956 | Soil | MSKKREPGECEKALSAAERKAALRRRREILDALMKILRGG* |
| JGI10216J12902_1157477421 | 3300000956 | Soil | MAGKREPDDREKALRAKERKAALRRRREIFDALMKVLRGE* |
| C688J35102_1192365482 | 3300002568 | Soil | VGDKGEQDGSAKTLSAKERKAALRRRREILDALLKVLRGH* |
| C688J35102_1209059174 | 3300002568 | Soil | MGGKRDHERQEASKAKARKAALRRRREILDALLKVLRAP* |
| JGI25390J43892_100115762 | 3300002911 | Grasslands Soil | MGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG* |
| Ga0063454_1005483982 | 3300004081 | Soil | MGEKDEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG* |
| Ga0062593_1003049593 | 3300004114 | Soil | MGEKREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG* |
| Ga0062593_1035281291 | 3300004114 | Soil | MVGKRDSDVREKPLTATERKAALRRRREILDALMKVLRGS* |
| Ga0062589_1007163572 | 3300004156 | Soil | MGEKREPDDREKALSAEERKAAALRRRREIYEALMKVLRGC* |
| Ga0062590_1006395442 | 3300004157 | Soil | MGEKREPDDREKALSAHERKAAALRRRREIYDALMKVLRGG* |
| Ga0062590_1024136132 | 3300004157 | Soil | MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLRGG* |
| Ga0063356_1031196693 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG* |
| Ga0062591_1016091261 | 3300004643 | Soil | SPASVDAMGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG* |
| Ga0062594_1008205231 | 3300005093 | Soil | MSGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGS* |
| Ga0066679_102257962 | 3300005176 | Soil | MGEKHEPADQEKVVSANEQKAALRRRRQIFDALMKVLRGG* |
| Ga0066688_101768143 | 3300005178 | Soil | MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVLRGG* |
| Ga0066688_109152822 | 3300005178 | Soil | MGEKRDSDDREKPLSAKERKAALRRRREILDALLKVLRGS* |
| Ga0066684_102150872 | 3300005179 | Soil | MGRKREPDDREKVLSAKEQKAALRRRREILDALMKVLRGS* |
| Ga0066684_108216323 | 3300005179 | Soil | ASHASFDAMGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG* |
| Ga0066671_105799201 | 3300005184 | Soil | MGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG* |
| Ga0066388_1001253376 | 3300005332 | Tropical Forest Soil | DAVGEKREPDDRKKPPSAKEQKAALRRRREIFDALMKVLRGG* |
| Ga0068869_1002801003 | 3300005334 | Miscanthus Rhizosphere | MGGKRESDDREKALRAEEQRAALRRRREIFDALMKVLRGG* |
| Ga0068868_1003843673 | 3300005338 | Miscanthus Rhizosphere | MGGKRDADDREKALRAEELKAALRRRREIFDALMKVLRGG* |
| Ga0070668_1003692153 | 3300005347 | Switchgrass Rhizosphere | MGGKREPDDREKALRAEEQKVALRRRREIFDALMKVLRGG* |
| Ga0070703_100057316 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG* |
| Ga0070709_100671213 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDRKNPLTATERKVALRRRREILDALMKVLRGS* |
| Ga0070709_102410583 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGENREPDDREKALSAEERKTAALRRRREIYDALMKALRGG* |
| Ga0070709_111764762 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVKREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG* |
| Ga0070714_1019178411 | 3300005435 | Agricultural Soil | AMGGKREPDDREKALRAKERKAALRRRREIFDALMKVLRGA* |
| Ga0070713_1003610472 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGS* |
| Ga0070710_101098613 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDREKPLTATERKVALRRRREILDALMKVLRGS* |
| Ga0070711_1000432374 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRESDDREKPLRAEEQKAALRRRREIFDALMKVLRGG* |
| Ga0070708_1002758482 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKREPDDRKKALSAEERKAALRRRREIYDALMKVLRGG* |
| Ga0070708_1006950421 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKREPDDREKALRAKERKAALRRRREIFDALMKVLRGA* |
| Ga0066686_108129162 | 3300005446 | Soil | MGGKRESDDREKPLSAKERKAALRRRREILDALLKALRGY* |
| Ga0066687_101754642 | 3300005454 | Soil | MGEKHEPADQEKVMSANEQKAALRRRRQIFDALMKVLRGG* |
| Ga0070706_1001851203 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGKRDLDDREKPLTATERKAALRRRREILDALMKVLRGS* |
| Ga0070707_1000434564 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRESDDRVKALRAKERKAALRRRREILDALMKVLRGG* |
| Ga0070697_1000640552 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVKREPDDREKALSAEERKAAALRRRREIYDALMKALRGG* |
| Ga0070697_1001919373 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGP* |
| Ga0070697_1005152863 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRESDDRAKALKAKERKAALRRRREILDALMKVLRGG* |
| Ga0066697_104472912 | 3300005540 | Soil | MGEKREDDREKALRAEQRKAALRRRREIFDALMKALRGG* |
| Ga0070695_1002143522 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDREKPLTATERKAALRRRREILDALIKVLRGP* |
| Ga0070704_1000553922 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDPDDREKALRTEELKAALRRRREIFDALMKVLRGG* |
| Ga0066701_102224713 | 3300005552 | Soil | MGGKREPDDREKTQRAKEREAALRRRREIFDALMKVLRGG* |
| Ga0066695_103923132 | 3300005553 | Soil | MGEKREDDREKALRAEERNAALRRRREIFDALMKVLRGG* |
| Ga0066707_105325013 | 3300005556 | Soil | MGEKREQTDRERPLSAKQRKAALRRRQEIFDALMKVLRGG* |
| Ga0066700_105328692 | 3300005559 | Soil | MGGKREPDDREKALRAKERKAALRRRREIFDALMKALRGA* |
| Ga0066699_101217622 | 3300005561 | Soil | MGEKHEPADQEKVMSSNEQKAALRRRRQIFDALMKVLRGG* |
| Ga0066694_101646902 | 3300005574 | Soil | MGEKREDDRKKALRAEERKAALRRRREIFDALMKVLRGG* |
| Ga0066708_105175661 | 3300005576 | Soil | GEKHEPADQEKVMSANEQKAALRRRRQIFDALMKVLRGG* |
| Ga0070702_1001142024 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEKREPDDREKALSAEERKAAALRRRREIYDALMKVLRG* |
| Ga0066905_1000709722 | 3300005713 | Tropical Forest Soil | VDAVGEKREPEDRKKPLSAREQKAALRRRREIFDALMKVLRGG* |
| Ga0066652_1000051293 | 3300006046 | Soil | VGGKRERDESPKPLSAKERKAALRRRREILDALLKVLRGY* |
| Ga0075432_100562192 | 3300006058 | Populus Rhizosphere | MGEKREPDDREKALSAKERKAAALRRRREIYDALMKVLRGG* |
| Ga0070715_100119122 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDRKNPLTATGRKVALRRRREILDALMKVLRGS* |
| Ga0066659_101558634 | 3300006797 | Soil | MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVLRGA* |
| Ga0066659_107609172 | 3300006797 | Soil | MGGKRDSDHREKPLSAKERKAALRRRREILDALLKVLRGS* |
| Ga0075434_1000503201 | 3300006871 | Populus Rhizosphere | MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLR |
| Ga0075424_1016230633 | 3300006904 | Populus Rhizosphere | REPDDREKALSAEERKAAALRRRREIYDALMKVLRGG* |
| Ga0066710_1004975891 | 3300009012 | Grasslands Soil | VGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG |
| Ga0114129_111802092 | 3300009147 | Populus Rhizosphere | MGEKREPDDREKAPSAKERKAAALRRRREIYDALMKVLRGG* |
| Ga0075423_104890292 | 3300009162 | Populus Rhizosphere | MGGKREPDKEEKPMSAKERKAALRRRLEIFDALMKVLRGG* |
| Ga0105242_112584642 | 3300009176 | Miscanthus Rhizosphere | MGENREPDDREKALSAEERKTAALRRRREIYDALMK |
| Ga0126310_108485342 | 3300010044 | Serpentine Soil | VGDKGEQDESAKTLSAKERKAAVRRRREILDALLKVLRGY* |
| Ga0126382_100011629 | 3300010047 | Tropical Forest Soil | VDAVGENQEPDDRKKPLSAEEQKAALRRRREIFDALMKVLRGG* |
| Ga0134080_101519302 | 3300010333 | Grasslands Soil | MGEKREDDREKALRAEERKAVLRRRREIFDALMKVLRGG* |
| Ga0134071_100918032 | 3300010336 | Grasslands Soil | MGEKREDDREKALRAEERKAALRRRREIFDALMKALRGG* |
| Ga0134128_128594472 | 3300010373 | Terrestrial Soil | MGGKRESDDREKALRAEEKRAALRRRREIFDALMKVLRGG* |
| Ga0134127_112320281 | 3300010399 | Terrestrial Soil | MGEKREPDDREKAPSAEERKAAALRRRREIYDALMKVL |
| Ga0137364_109586712 | 3300012198 | Vadose Zone Soil | MGEKREDDREKTLRAEQRKAALRRRREIFDALMKMLRGG* |
| Ga0137383_113137232 | 3300012199 | Vadose Zone Soil | MGGKRDSDDREKPLSAKERKAALRRRREILDALLKVLRGS* |
| Ga0137382_104189233 | 3300012200 | Vadose Zone Soil | MGEKNEPADQEKVMSANEQKAALRRRRQILDALMKVLRGG* |
| Ga0137382_106118202 | 3300012200 | Vadose Zone Soil | MGGKRNSDHREKPLSAKERKAALRRRREILDALLKVLRGS* |
| Ga0137382_112230451 | 3300012200 | Vadose Zone Soil | MDGKREPDDCKKPLTAKERKAALRRRREILDALLKALRGE* |
| Ga0137365_100118875 | 3300012201 | Vadose Zone Soil | MGGKRDSDDREKPLSAKEGKAALRRRREILDALLKVLRGS* |
| Ga0137365_106838792 | 3300012201 | Vadose Zone Soil | MGGKREPDEQGKPLTEEERKAALRRRREILDALLKALRGS* |
| Ga0137380_100988392 | 3300012206 | Vadose Zone Soil | MGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGGYP* |
| Ga0137376_100790031 | 3300012208 | Vadose Zone Soil | HASFDALGEKHEPADQEKVVSANVQKAALRRRRQIFNALMKVLRGG* |
| Ga0137376_103570882 | 3300012208 | Vadose Zone Soil | MGEKHEPGDQEKVVSANERKAALRRRRQIFDVLMKVLRGG* |
| Ga0137376_108126222 | 3300012208 | Vadose Zone Soil | MGEKREQADRERPLSAKQRKAALRRRREIFDALMKVLRGG* |
| Ga0137379_103740422 | 3300012209 | Vadose Zone Soil | MGEKREDDREKALRAEERKAVLRRRREIFDALMKVLRGGYP* |
| Ga0137377_100111625 | 3300012211 | Vadose Zone Soil | MGGKREPNDREKALRAKERKAALRRRREIFDALMKALRGG* |
| Ga0137387_101305141 | 3300012349 | Vadose Zone Soil | KREDDREKALRAEERKAVLRRRREIFDALMKVLRGG* |
| Ga0137372_100295735 | 3300012350 | Vadose Zone Soil | MSGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGGYP* |
| Ga0137372_101478742 | 3300012350 | Vadose Zone Soil | MDGKHEPAERKKPLTAKERKAALRRRREILDALLKALRGY* |
| Ga0137367_104938332 | 3300012353 | Vadose Zone Soil | MGGKSEPDDREKALRAEEQKAALRRRREIFDALMKVLRGGYP* |
| Ga0137366_101193622 | 3300012354 | Vadose Zone Soil | MDGKHEPAERKKSLTAKERKAALRRRREILDALLKALRGY* |
| Ga0137371_112714373 | 3300012356 | Vadose Zone Soil | GKRESDDREKPLSAKERKAALRRRREILDALLKALRGY* |
| Ga0137360_112174832 | 3300012361 | Vadose Zone Soil | MGAKREPDDREKALGAKERKAALRRRREIFDALMKVLRGG* |
| Ga0137361_112383263 | 3300012362 | Vadose Zone Soil | MGGKRDSDDGEKPLSAKERKAALRRRREILDALLKVLRGS* |
| Ga0157303_100231211 | 3300012896 | Soil | EPDDREKALSAEERKAAALRRRREIYEALMKVLRGC* |
| Ga0157306_102136192 | 3300012912 | Soil | MGGKREPDDREKAVRAEEQKAALRRRREIFDALMKVLRGG* |
| Ga0137404_100452277 | 3300012929 | Vadose Zone Soil | SPASVDPMGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG* |
| Ga0164303_108623873 | 3300012957 | Soil | MGGKHESNDREKPLSAKERKAALRRRREILDALLKVLRGS* |
| Ga0164299_101693124 | 3300012958 | Soil | VDAMGGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG* |
| Ga0164301_102930384 | 3300012960 | Soil | GAMGGKHESNDREKPLSAKERKAALRRRREILDALLKVLRGS* |
| Ga0134076_104924432 | 3300012976 | Grasslands Soil | MGEKREDDREKALRAEERKAALRRRRDIFDALMKVLRGG* |
| Ga0164307_105996843 | 3300012987 | Soil | ALASLDAMGGKRDSDDREKPLTATERKAALRRRREILDALMKVLRGS* |
| Ga0164305_106633482 | 3300012989 | Soil | MGGKRDSDDREKPLTATERKAALRRRREILDALMKALRGS* |
| Ga0157374_105198031 | 3300013296 | Miscanthus Rhizosphere | SVDAMGGKRESDDREKALRAEEQRAALRRRREIFDALMKVLRGG* |
| Ga0157378_101954604 | 3300013297 | Miscanthus Rhizosphere | MGEKREPDDREKALSAEERKTAALRRRREIYDALMKALRGG* |
| Ga0157372_117212962 | 3300013307 | Corn Rhizosphere | MGGKREPDDREKDLRAEEQKVALRRRREIFDALMKVLRGG* |
| Ga0157375_104308223 | 3300013308 | Miscanthus Rhizosphere | MGGKREPDDREKALRAEEQRAALRRRREIFDALMKVLRGG* |
| Ga0120123_11354342 | 3300013770 | Permafrost | MGGKREHHDREKALSAKDDKAALRRRREILSALMKVLRGS* |
| Ga0134078_103487852 | 3300014157 | Grasslands Soil | MGEKREHDREKAPRAKERKAALRRRREIFDALMKVLRGG* |
| Ga0134072_103938181 | 3300015357 | Grasslands Soil | VDAMGRKREPDDREKVLSAKEQKAALRRRREILDALMKVLRGS* |
| Ga0184605_100242874 | 3300018027 | Groundwater Sediment | MDGKRESDERKKTLTVKERKAALRRRREILDALLKALRGY |
| Ga0184605_100743672 | 3300018027 | Groundwater Sediment | MGGKRESDDREKALRAEEQKAALRRRREIFDALMKVLRGG |
| Ga0184608_100580654 | 3300018028 | Groundwater Sediment | MGEKREDDREKASRAKERKAALRRRREIFDALMKVLRGG |
| Ga0184619_100011364 | 3300018061 | Groundwater Sediment | MDGKRESDERKKTLTAKERKAALRRRREILDALLKALRGY |
| Ga0184619_100411632 | 3300018061 | Groundwater Sediment | MGGKREHDDREKALRAKDDKAALRRRREILSALMKVLRGS |
| Ga0184619_103375331 | 3300018061 | Groundwater Sediment | MGGKREPDDQEKALRAEEQKAALRRRREIFDALMK |
| Ga0184618_103348242 | 3300018071 | Groundwater Sediment | MGGKRESDDREKALRAEEQKAALRRRRELFDALMKVLRGG |
| Ga0066655_105182321 | 3300018431 | Grasslands Soil | MGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG |
| Ga0066655_110019202 | 3300018431 | Grasslands Soil | MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVL |
| Ga0066667_100092695 | 3300018433 | Grasslands Soil | MGEKREQTDRERPLSAKQRKAALRRRREIFDALMKVLRGG |
| Ga0066667_100858191 | 3300018433 | Grasslands Soil | MGEKHEPADQEKVMSANEQKAALRRRRQIFDALMKVLRGG |
| Ga0066667_111150611 | 3300018433 | Grasslands Soil | MGEKREDDREKALRAEERKAALRRRREIFDALMKVLRGG |
| Ga0066667_118520731 | 3300018433 | Grasslands Soil | MGGKREPDDREKTQRAKEREAALRRRREIFDALMKVLRGG |
| Ga0190269_115566503 | 3300018465 | Soil | MGGKREPDDREKALRAEEQKAALRRRREILDALMKVLRGG |
| Ga0066662_103147342 | 3300018468 | Grasslands Soil | MGGKRGSDHREKPLSAKERKAALRRRREILDALLKVLRGS |
| Ga0066669_109995803 | 3300018482 | Grasslands Soil | MGEKREHDREKASRAKERKAALRRRREIFDALMKVLRGG |
| Ga0173482_102603932 | 3300019361 | Soil | MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLRGG |
| Ga0193704_10950342 | 3300019867 | Soil | MGGKRESDDREKALRAEKQKAALRRRREIFDALMKVLRGG |
| Ga0193729_10025933 | 3300019887 | Soil | MGGKRDSDDREKRLSAKERKAALRRRREILDALLKVLRGS |
| Ga0193728_10059183 | 3300019890 | Soil | MGGKREHDDREKAPSAKDDKAALRRRREILSALMKVLRGS |
| Ga0210382_103632982 | 3300021080 | Groundwater Sediment | MGGKREPDDQEKALRAEEQKAALRRRREIFDALMKVLRGG |
| Ga0207653_100247472 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG |
| Ga0207692_100565863 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDREKPLTATERKVALRRRREILDALMKVLRGS |
| Ga0207642_103387091 | 3300025899 | Miscanthus Rhizosphere | GKRESDDREKPLRAEEQKAALRRRREIFDALMKVLRGG |
| Ga0207688_100134613 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKREPDDREKALRAEEQKVALRRRREIFDALMKVLRGG |
| Ga0207685_103949751 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EPDDREKALSAEERMAAALRRRREIYDALMKVLRGG |
| Ga0207699_100251863 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDRKNPLTATERKVALRRRREILDALMKVLRGS |
| Ga0207699_105013962 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEKREPDDREKALSAHERKAAALRRRREIYDALMKVLRGG |
| Ga0207684_101685784 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DAMGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRG |
| Ga0207695_116208542 | 3300025913 | Corn Rhizosphere | MGGKREPDDREKALRAEEQKAALRRRREIFDALMK |
| Ga0207681_114104222 | 3300025923 | Switchgrass Rhizosphere | MGGKRESDDREKALRAEEQRAALRRRREIFDALMKVLRGG |
| Ga0207700_116691742 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDRKNPLTATERKAALRRRREILDALMKVLRGS |
| Ga0207664_105136412 | 3300025929 | Agricultural Soil | MGGKRDSDDREKPLTATERKAALRRRREILDALIKVLRGP |
| Ga0207644_107052292 | 3300025931 | Switchgrass Rhizosphere | MGENREPDDREKALSAEERKAAALRRRREIYDALMKALRGG |
| Ga0207665_100104799 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGKRDSDDREKPLTATETERKAALRRRREILDALMKVLRGS |
| Ga0207712_101625711 | 3300025961 | Switchgrass Rhizosphere | MGGKREPDDREKALRAEEQKVALRRRREIFDALMK |
| Ga0207640_102515601 | 3300025981 | Corn Rhizosphere | HPASVDAMGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRGG |
| Ga0207639_119153521 | 3300026041 | Corn Rhizosphere | MGGKREPDDREKALRAEEQKVALRRRREIFDALMKVLR |
| Ga0207675_1000263363 | 3300026118 | Switchgrass Rhizosphere | MGGKREPDDREKALRAEEQRAALRRRREIFDALMKVLRGG |
| Ga0207683_103375324 | 3300026121 | Miscanthus Rhizosphere | MGENREPDDREKALSAEERKAAALRRRREIYDALMKVLRG |
| Ga0209234_10581853 | 3300026295 | Grasslands Soil | MGEKHEPADQEKVVSANEQKAALRRRRQIFDALMKVLRGG |
| Ga0209470_11738691 | 3300026324 | Soil | MGEKREDDREKALRAEERKAALRRRRDIFDALMKVLRGG |
| Ga0209159_12458622 | 3300026343 | Soil | MGEKREDDREKALRAEERNAALRRRREIFDALMKVLRGG |
| Ga0209378_11036352 | 3300026528 | Soil | MGEKREDDRKKALRAEERKAALRRRREIFDALMKALRGG |
| Ga0209807_11954162 | 3300026530 | Soil | SFDAMGEKHEPADQEKVVSANVQKAALRRRRQIFDALMKVLRGG |
| Ga0209474_100694194 | 3300026550 | Soil | MGRKREPDDREKVLSAKEQKAALRRRREILDALMKVLRGS |
| Ga0209577_104074402 | 3300026552 | Soil | MGRKREPDDREKVLSAKALRRRREILDALMKVLRGS |
| Ga0207499_1028562 | 3300026792 | Soil | MGGKREPDKEEKPMSAKERKAALRRRREIFDALMKVLRG |
| Ga0207555_1007862 | 3300026974 | Soil | MGGKREPDDREKAVRAEEQKAALRRRREIFDALMKVLRGG |
| Ga0307276_100628871 | 3300028705 | Soil | MDGKREPDERKKPLTGKERKAALRRRREILDALLKALRGY |
| Ga0307307_100086382 | 3300028718 | Soil | MDGKRERDERQKPLTAKERKAALRRRREILDAVLKALRGY |
| Ga0307280_102149382 | 3300028768 | Soil | MGGKREHDDREKAPSAKDDKPALRRRREILSALMKVLRGS |
| Ga0307282_104967691 | 3300028784 | Soil | EPDERKKPLTGKERKAALRRRREILDALLKALRGY |
| Ga0307323_101929501 | 3300028787 | Soil | MGEKREDDREKASRAKERKAALRRRREIFDALMKVLRGVR |
| Ga0307323_102353013 | 3300028787 | Soil | VEAMGEKREDDREKASRAKERKAALRRRREIFDALMKVLRGG |
| Ga0307305_100215326 | 3300028807 | Soil | KREDDREKASRAKERKAALRRRREIFDALMKVLRGG |
| Ga0307310_105106352 | 3300028824 | Soil | MGGKREHDDQEKALRVKDDKAALRRRREILSALMKVLRGS |
| Ga0307277_100153976 | 3300028881 | Soil | VGDKGEQDESAKTLSAKKRKAALRRRREVLDALLKVLRGQ |
| Ga0307277_100316762 | 3300028881 | Soil | VDDKREPDERKKPLTAKEQKAALRRRREVLDALLKALRGH |
| Ga0307277_101243433 | 3300028881 | Soil | VGCKREQDESAKSLSAKERRAALRRRREILDALLK |
| Ga0310886_102118842 | 3300031562 | Soil | MGENRKPDDREKALSAEERKAAALRRRREIYDALMKVLRGG |
| Ga0307468_1022853271 | 3300031740 | Hardwood Forest Soil | GGKREPDDREKALRAEEQKAALRRRREIFDALMKVLRGG |
| Ga0308175_1031962702 | 3300031938 | Soil | VGEKREPAECRKALTAKEQKAALRRRRELLDTLMKVLRGG |
| Ga0310890_102285731 | 3300032075 | Soil | ASVDAMGENREPDDREKALSAEERKAAALRRRREIYDALMKVFRGG |
| Ga0307472_1003308374 | 3300032205 | Hardwood Forest Soil | MGGKRDLDDREKPLTASERKAALRRRREILDALMKVLRGS |
| Ga0310811_107011662 | 3300033475 | Soil | MGEKREPDDREKALSAEERKAAALRRRREIYEALMKVLRGG |
| ⦗Top⦘ |