Scaffold Ga0120997_100802

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120997_100802

Scaffold Ga0120997_100802

Overview

Basic Information
Taxon OID	3300010005 Open in IMG/M
Scaffold ID	Ga0120997_100802 Open in IMG/M
Source Dataset Name	Microbial communities associated with xenic strain Fischerella muscicola UTEX 1829
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	21025
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (72.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Microbial Communities Associated With Xenic Strain Fischerella Muscicola Utex 1829

Source Dataset Sampling Location
Location Name	UTEX collection
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102772	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120997_1008023	F102772	AGGA	MSNDASRLRAILSAASVYLFFEAGLAAQTVDELPDPQEPMLAEPGDWAADFNEAQSACYQGSMRACDSIWLSERVLLDSFLDHYGRTCGGRVDLREIRRANLNCTEAFPGHD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.