3300010005: Microbial communities associated with xenic strain Fischerella muscicola UTEX 1829

Overview

Basic Information

• IMG/M Taxon OID: 3300010005
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118857 | Gp0141690 | Ga0120997
• Sample Name: Microbial communities associated with xenic strain Fischerella muscicola UTEX 1829
• Sequencing Status: Permanent Draft
• Sequencing Center: Oregon State University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 125595532
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities Associated With Xenic Strain Fischerella Muscicola Utex 1829
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Microbial Communities Associated With Xenic Strain Fischerella Muscicola Utex 1829

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant corpus

Location Information

• Location: UTEX collection
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102772	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0120997_100802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	21025

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120997_100802	Ga0120997_1008023	F102772	MSNDASRLRAILSAASVYLFFEAGLAAQTVDELPDPQEPMLAEPGDWAADFNEAQSACYQGSMRACDSIWLSERVLLDSFLDHYGRTCGGRVDLREIRRANLNCTEAFPGHD*