Basic Information | |
---|---|
Taxon OID | 3300009995 Open in IMG/M |
Scaffold ID | Ga0105139_1105766 Open in IMG/M |
Source Dataset Name | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 543 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Austin, Texas | |||||||
Coordinates | Lat. (o) | 30.387 | Long. (o) | -97.7301 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073003 | Metagenome / Metatranscriptome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105139_11057662 | F073003 | GAGG | MASPWVVGVKIAGRKLKMIRDKSRGVENLLKDSSSMGSGGQGR |
⦗Top⦘ |