NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105029_101086

Scaffold Ga0105029_101086


Overview

Basic Information
Taxon OID3300009984 Open in IMG/M
Scaffold IDGa0105029_101086 Open in IMG/M
Source Dataset NameSwitchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1630
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions

Source Dataset Sampling Location
Location NameUSA: Austin, Texas
CoordinatesLat. (o)30.387Long. (o)-97.7301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091151Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0105029_1010861F091151AGGAGVRPGLDSRFLQVGPSSGPRLPREDWAGWHHIGGQDVELTFYRRRSYRIVFRTQF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.