| Basic Information | |
|---|---|
| Family ID | F091151 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VRPGLDNRFLLGGPSSGPRLPREDRAGWHHIGGQDVELTLYRRRGYRIVF |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.81 % |
| % of genes near scaffold ends (potentially truncated) | 71.03 % |
| % of genes from short scaffolds (< 2000 bps) | 98.13 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.458 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (62.617 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.785 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (62.617 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.64% Coil/Unstructured: 74.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.46 % |
| All Organisms | root | All Organisms | 6.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 62.62% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 13.08% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 11.21% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Host-Associated | Open in IMG/M |
| 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028465 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032548 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032822 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032825 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032890 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032953 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070667_1018232291 | 3300005367 | Switchgrass Rhizosphere | VRPGLDSRFLLGGPSSGPRLPREDRAGWRHIGGQDVELTLYHRRGYRIVFRTQ |
| Ga0068859_1022845231 | 3300005617 | Switchgrass Rhizosphere | VRPGLDNRFLLGGPSSGPRLPREDRAGWHHIGGQDVELTLYRRRGY |
| Ga0068861_1022768011 | 3300005719 | Switchgrass Rhizosphere | VRPGLDSHFLLGGPSSGPRLPREDWAGWRHIGGQDVELT |
| Ga0068862_1010952711 | 3300005844 | Switchgrass Rhizosphere | PGLDSRFLQVGPSSGPRLPREDWAGWHHIGGQDV* |
| Ga0105136_1078311 | 3300009973 | Switchgrass Associated | VHPGLDSRFLLGGPSSGPHLPCEDRAGWHHIGGQDVELT |
| Ga0105129_1040951 | 3300009975 | Switchgrass Associated | VRPGLDNRFLLGGPSSGPRLPREDRVGWRHIGGQDVELTLYRRHGYHIVFRTRS* |
| Ga0105128_1045661 | 3300009976 | Switchgrass Associated | VRPGLDSRFLQVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRIVFRTQF* |
| Ga0105128_1074891 | 3300009976 | Switchgrass Associated | VRPELDNCFLLGGPSSGPHLSHEDRAGWHHIGGQDVKLTLYRRRG |
| Ga0105128_1180821 | 3300009976 | Switchgrass Associated | RFLLGGPSSGPRLPREDRAGWHHISGQDVELGLLVQL* |
| Ga0105135_1234041 | 3300009980 | Switchgrass Associated | MSVRPGLDSRFLLGGPSSGPRLPREDRAGWHHIGGQDVELTLYRRR |
| Ga0105029_1010861 | 3300009984 | Switchgrass Rhizosphere | VRPGLDSRFLQVGPSSGPRLPREDWAGWHHIGGQDVELTFYRRRSYRIVFRTQF* |
| Ga0105030_1111931 | 3300009987 | Switchgrass Rhizosphere | VRPGLDSRFLQVGPSSGPRLPREDRAGWRHIGGQDVELCLYHRRGYRIVFRTQF* |
| Ga0105131_1087231 | 3300009989 | Switchgrass Associated | VRPGLDNHFLLVGPSSGPRLPREDRTGWPHIGGQDVELTLYRR |
| Ga0105131_1223051 | 3300009989 | Switchgrass Associated | VRPGLDSRFLRVGPSSGPHLPREDRACWHHIGGQDVKLTLYRRRGYRIVFR |
| Ga0105132_1135791 | 3300009990 | Switchgrass Associated | VRPGLDSRFLRVGLSSGPRLPREEWAGWHHIGGQDVE |
| Ga0105139_10072641 | 3300009995 | Switchgrass Associated | PLTSRRSVRPGLDNRFLRVGPSSGPRLSREDRAGWHHIGGQDVELTLYRRS* |
| Ga0105139_10304141 | 3300009995 | Switchgrass Associated | VRPGLDNRFLLGGPLSGPRFPREVRADWHHIGGQDVELTVY |
| Ga0105139_10984761 | 3300009995 | Switchgrass Associated | VRPGLDSRFLLGGPSSGPHLPREDWAGWHHIGGQDVELTFYRRRGYRIVFRTQF |
| Ga0134125_119172792 | 3300010371 | Terrestrial Soil | VRPGLDSRFLLGGPSSGPCLPREDRAGWRHIGGQDVELTFYHR |
| Ga0134125_125373501 | 3300010371 | Terrestrial Soil | TSRRSVRPGLDSRFLRVGPSSRPRLPREDWASWHHIGGPDVELTLYRHRGYRIVFRTRF* |
| Ga0134124_115420421 | 3300010397 | Terrestrial Soil | SLRTSRRSVRPGLDSRFLQVGPSSGPRVPREDWAGWRHIGGQDVELTFYRHRSYRIVFRTQF* |
| Ga0134127_118802181 | 3300010399 | Terrestrial Soil | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQNVE |
| Ga0134122_131150531 | 3300010400 | Terrestrial Soil | VRPGLDNRFLLGGPSSGPRLPREDWAGWYHIDGQDVELTLYRRRVYRIVFRTRFFKLPLCI* |
| Ga0182102_10384301 | 3300015273 | Switchgrass Phyllosphere | VRPGLDSHSLQVGPSSGPRLPREGWAGWRHIGGQDVEL |
| Ga0182104_10979441 | 3300015297 | Switchgrass Phyllosphere | VRPGLDNRFLLGGPSSGSRLPREVRAGWHHIGGQDVELTLY |
| Ga0182104_11144501 | 3300015297 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDV |
| Ga0182184_10541521 | 3300015301 | Switchgrass Phyllosphere | RFLLGVPSSGSRLSREARAGWHHIGGQNVELTLYRRS* |
| Ga0182162_10842671 | 3300015310 | Switchgrass Phyllosphere | YARPGLDSCFLLGGLSSGPRLPREDRAGWPHIGGQDVELTLYRRS* |
| Ga0182120_11034951 | 3300015315 | Switchgrass Phyllosphere | VRPGLDNRFLLGGPSSGPRLPREDRAGWHHIGGQDVELTLYRRRGYRIVFRT |
| Ga0182120_11244881 | 3300015315 | Switchgrass Phyllosphere | SVRPGLDSRFLLGGPSSGPRLPREDRAGWHHIGGQDVELTLYRRS* |
| Ga0182136_10340771 | 3300015317 | Switchgrass Phyllosphere | VRPGLDNRSLLGGLSSGPRLPREDRAGWYHIGGRDVELALY |
| Ga0182136_10986831 | 3300015317 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWHHIGGQDVELT |
| Ga0182165_11097711 | 3300015320 | Switchgrass Phyllosphere | MRSVRPGLDNHFLLGGPSSGPRLPREDRAGCHHIGGQDVELTLYRHRGYRIVF |
| Ga0182134_10502741 | 3300015324 | Switchgrass Phyllosphere | RPGLDNHFLLGGPSCGPRLLREVRAGLHHIGGQDVELTLYHRS* |
| Ga0182148_10979711 | 3300015325 | Switchgrass Phyllosphere | LTSRRSVRPGLDSRFLRVGPSSGPRLPHEDWASWHHIGGPDVELTLYHRHGYRIVFRTRF |
| Ga0182166_10754531 | 3300015326 | Switchgrass Phyllosphere | TSRRSARPGLDNHFLLGGPSSEPRFPREVRAGWHHIGGQDVELTVYRRS* |
| Ga0182153_11496141 | 3300015328 | Switchgrass Phyllosphere | RPGLDSRFLQVGPSSGPRLPREDWAGWHHISGQDV* |
| Ga0182135_10819421 | 3300015329 | Switchgrass Phyllosphere | VRPGLDSRFLLGGPLSGPRLPREDWASWHHIDGQGVELTLY |
| Ga0182135_10890841 | 3300015329 | Switchgrass Phyllosphere | VRPGLDSRFLQVGQSSGPRLPREDRTGWHHIGGQDVELAVYRRRGYRIVFRIQF* |
| Ga0182131_10120531 | 3300015331 | Switchgrass Phyllosphere | VGPGLDNRFLQVEPSSGPHLPREDRAGWHHIGGQDVELALYRRRGYRIVF* |
| Ga0182131_10239011 | 3300015331 | Switchgrass Phyllosphere | RRSVRSGLDNCFLLVGPSSGPRLPHEDRAGWHHIGGQDVELTLYRRS* |
| Ga0182117_11423251 | 3300015332 | Switchgrass Phyllosphere | SVRPRLDNRFLLGGPSSGPRLPREVRAGWHHIGGQDVELTSYRHS* |
| Ga0182117_11627691 | 3300015332 | Switchgrass Phyllosphere | PGLDNHFLLGGPSSGPRLPREDRAGWHHIGGQNVELTLYRRRGYRSVFRTRF* |
| Ga0182132_10516351 | 3300015334 | Switchgrass Phyllosphere | VRPGLDSRILLGGPSSGPCLLREDRAGWHHIGGQDVDLTLYRRRGYHIVFRTQ |
| Ga0182116_10939161 | 3300015335 | Switchgrass Phyllosphere | VRPGLDNRFLQVGPSSGPRLPREDRAGWHHIGGQDVELTLYR |
| Ga0182116_11325411 | 3300015335 | Switchgrass Phyllosphere | VRPGLDNHLLLGGPSSGPHLPHEDRAGWYHISRQDVELTWYRRRGYRIVFQTQF* |
| Ga0182150_11110631 | 3300015336 | Switchgrass Phyllosphere | VRPGLDSRFLLGGLSSGPRLSREDWAGWHHIGGQDVELTLYDRRGYRIVF |
| Ga0182115_12525971 | 3300015348 | Switchgrass Phyllosphere | FLRVGPSSGPHLPRENQSGWHHIGGHDVELTLYRRS* |
| Ga0182185_12169361 | 3300015349 | Switchgrass Phyllosphere | PLTSRRSARPGLDSRFLLGGPSSGPRLLREDRAGWHHIGGQDVELTLYRRRGYRIVFRTRF* |
| Ga0182179_10082061 | 3300015353 | Switchgrass Phyllosphere | VHPGLDSRFLLGGPSSGPRLPHEDRAGWHHIGGQDVELTLYRRRGYRIVFLNSVFKLPLCF* |
| Ga0182179_10456671 | 3300015353 | Switchgrass Phyllosphere | GLDNHFLLGGPFSGFRLLREARAGWHHIGGQNVELILYRRS* |
| Ga0182197_10744461 | 3300017408 | Switchgrass Phyllosphere | VRPGLDNRFLLGGPSSGPRLPREDRAGWHHIGGHDVELTLYHRRGYRIVI |
| Ga0182197_11197231 | 3300017408 | Switchgrass Phyllosphere | VHPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYR |
| Ga0182199_11343781 | 3300017412 | Switchgrass Phyllosphere | VRPGLDSRFLRVRPSSGPRLPREDRAGWYHIGGQDVELALYRRRGY |
| Ga0182196_10757221 | 3300017432 | Switchgrass Phyllosphere | MHPGLGNCFLLGGLPSGPRLPREARAGWHHIGGQDVELTLYRRCSYLIVFRTRF |
| Ga0182214_10628781 | 3300017440 | Switchgrass Phyllosphere | VRPGLVSRFLRVGPSSGPRLPREDRAGWRHIGGQDVELTLYRRR |
| Ga0182198_11275741 | 3300017445 | Switchgrass Phyllosphere | RRSVCPGLDNRFLLGGPSSGPHLPCEDRADWPHIGGQDVELALNRRRGYRIVFRTQF |
| Ga0182217_10887681 | 3300017446 | Switchgrass Phyllosphere | VRSGLDNCFLLVGPSSGPRLPHEDRAGWPHIGGQDV |
| Ga0182215_10815461 | 3300017447 | Switchgrass Phyllosphere | VRPGLDNRFLLGGPSSGPRLPREDRAGWHHIGGQDVELTLYRRRGYRIVF |
| Ga0182216_10647221 | 3300017693 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRIVFRTQF |
| Ga0182216_11475821 | 3300017693 | Switchgrass Phyllosphere | SVRPGLDNRFLRVGPSSGPRLPREDWADWHHISGQDVELTLYRRS |
| Ga0182216_11976961 | 3300017693 | Switchgrass Phyllosphere | VRPGLDNRFLLGGPSSGPCLPREDRAGWHHIGGQDVELTWYRRRGYRI |
| Ga0207670_102041591 | 3300025936 | Switchgrass Rhizosphere | MRPGLDNRFLLGGPSSGPSLLREDRAGWHHIGGQDVELTFYRHRSYRIVFRTQF |
| Ga0207675_1009455611 | 3300026118 | Switchgrass Rhizosphere | PGLDSRFLRVGPLSGPHLPREDRAGWHHISGQDVELTFYRRRGYRIVFRTQF |
| Ga0268330_10257221 | 3300028056 | Phyllosphere | VHPGLDSRFLLGGPSSGPRLPHEDRAGWHHIGGQDVELTLYRRRGYRIVFLNSVFKLPLC |
| Ga0268332_10287231 | 3300028058 | Phyllosphere | RYVHPGLDSRFLLGGPSSGPRLPHEDRAGWHHIGGQDVELTLYRRRGYRIVFLNSVFKLPLCF |
| Ga0268342_10375481 | 3300028062 | Phyllosphere | VRPGLDSRFLQVGPSSGPRLPREDWAGWHHIGGQDVELTFY |
| Ga0268342_10409841 | 3300028062 | Phyllosphere | LRPGLDNRFLQVGPSSGPRLPREDRAGWHHIGGQDVELTLYRRS |
| Ga0268340_10087241 | 3300028064 | Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRFVFRT |
| Ga0268340_10816841 | 3300028064 | Phyllosphere | VRPGLDSRFLLGGPSSGPRLPREDWAGWRHIGGQDVELTFYRRR |
| Ga0268326_10003071 | 3300028141 | Phyllosphere | VRPGLDSRFLQVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRIVFRTQF |
| Ga0268347_10346021 | 3300028142 | Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRCSYCI |
| Ga0268348_10151631 | 3300028143 | Phyllosphere | VRPGLDNHFLLGGLSSGSRLLREGRADRHHIGGQDVALTLYRRRGYR |
| Ga0268341_10249041 | 3300028154 | Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRIVF |
| Ga0268264_115631232 | 3300028381 | Switchgrass Rhizosphere | VRPGLDNRFLLGGPSSGPRLPREDRAGWHHIGGQDVEL |
| Ga0268301_1026851 | 3300028465 | Phyllosphere | RFLQVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRIVFRTQF |
| Ga0268305_1118991 | 3300028525 | Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRFIFRTQ |
| Ga0268339_10137761 | 3300028526 | Phyllosphere | GLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRIVFRTQF |
| Ga0268335_10129491 | 3300028527 | Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWCHIGGQDVELTFYRRRSYRIVF |
| Ga0214493_11101181 | 3300032465 | Switchgrass Phyllosphere | VRPGLDNRFLQVGPSSGPRLSREDRAGWRHIGGQDVELALY |
| Ga0214493_11304771 | 3300032465 | Switchgrass Phyllosphere | VRPRLDSRFLLGGPSCGPRLPREDRAGWRHIGGQDVELTLYHRRGYRIVFRTQF |
| Ga0214503_12124341 | 3300032466 | Switchgrass Phyllosphere | RRSVRPGLDSRFLQVGPSSGPRLPREDRAGWHHIGGQDVELALYRRRGYRIVF |
| Ga0214502_11322501 | 3300032514 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDRAGWHHIGGQDVELTLYRRRGYRIVFRTRFLTSTVYFNSMVCI |
| Ga0214483_10266061 | 3300032548 | Switchgrass Phyllosphere | VRPGLDSHFLQVGPSSGPRLPREDWAGWRHIGGQDVELTFYHRRSYRIVFQLSFELPLCV |
| Ga0214500_10548281 | 3300032589 | Switchgrass Phyllosphere | RPGLDNRFLQVGPSSGPRLPREDRAGWHHIGGQDVELTLYRRRGYHIVFRTRF |
| Ga0214504_10869991 | 3300032592 | Switchgrass Phyllosphere | VRPGLDSRFLLGGPSSGPRLPREDRAGWRHIGGQDVKLTFYRRRSYRIVFRTKF |
| Ga0214501_10791292 | 3300032625 | Switchgrass Phyllosphere | VRPGLDNRFLQVGQSSGPHLPREDRAGWHHIGGQDV |
| Ga0214499_10758462 | 3300032697 | Switchgrass Phyllosphere | DSHFLLGGLSSGPRLPREDRAGWHHIGGQDVELTLYRRRGYRIVF |
| Ga0214499_12253181 | 3300032697 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWHHIGGQDVELTFYRRRSYR |
| Ga0214485_10345051 | 3300032698 | Switchgrass Phyllosphere | VRPGLDSRFLQVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRRSYRIVFRTQFKTSAVRLNSVVCI |
| Ga0314746_10978581 | 3300032758 | Switchgrass Phyllosphere | VRPGLDSRFLLGGPSSGPRLLREDWAGWHRIGGQDVELTLYHRRGYRIVFRTQF |
| Ga0314754_10154362 | 3300032760 | Switchgrass Phyllosphere | VCPGLDNRFLLGGPSSGPRLPREDWAGWHHIGGQDVELALYHRRGYRIVFRTQFLILPLC |
| Ga0314733_10702061 | 3300032761 | Switchgrass Phyllosphere | VRSGLDNRFLQVGPSSGPRLPREDRAGWHHIGGQDVELTFILVGSYRIVF |
| Ga0314731_10455851 | 3300032790 | Switchgrass Phyllosphere | VRPGLDNRFLRVGPSSGPRLPREDRVGWHHIGGQDVELTLYRRRGYRIVFRTRF |
| Ga0314731_10746011 | 3300032790 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFY |
| Ga0314748_10777831 | 3300032791 | Switchgrass Phyllosphere | VRPGLDNHFLLGGLSSGSRLLREDWAGWHHIGGQDVELTLYRRRDYCIVFRTRFLNFC |
| Ga0314740_10624251 | 3300032822 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWRHIGGQDVELTFYRRR |
| Ga0314723_10700211 | 3300032823 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLLREDRIGWHHIGGQDVELALYRRRGYRIVF |
| Ga0314724_1172231 | 3300032825 | Switchgrass Phyllosphere | SLRTSRRSVRPGLDSRFLRVGPSSGPRLPREDWAGWHHIGGQDV |
| Ga0314743_10754881 | 3300032844 | Switchgrass Phyllosphere | VRPGLDNRFLQVGPSSGPRLPREDRAGWHHIGGQDVELTLYRRRGYHIVFRTRF |
| Ga0314747_10271692 | 3300032890 | Switchgrass Phyllosphere | VRPGLDNRFLRVGPSSGPRLPREDRVGWHHIGGQDVELTLYRRRGYRIVFRTRFLTSTVYFNSMVCI |
| Ga0314734_10317191 | 3300032916 | Switchgrass Phyllosphere | LDNRFLLGGPSSGPRLPREDWAGWHHIGGQDVELALYHRRGYRIVFRTQFLILPLCF |
| Ga0314729_1094231 | 3300032953 | Switchgrass Phyllosphere | VRPVLDNRFLLGGPSSGPRLPREDRAGWRHIGGQDVELTLYHRRGYRIVFRTQF |
| Ga0314729_1115421 | 3300032953 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLTREDWAGWHHIGGQDVELTLYHRRGYRIVFRTQFLNF |
| Ga0314758_11979021 | 3300033525 | Switchgrass Phyllosphere | VRPGLDSRFLRVGPSSGPRLPREDWAGWHHIGGQDVELTLYRRRGYRIVFRTQ |
| Ga0314767_11276831 | 3300033532 | Switchgrass Phyllosphere | VCPGLDSRFLLGGPSSGPRLRREDRAGWRHIGGQDVELTFYRYHSYHIVFRTQF |
| Ga0314755_10740161 | 3300033538 | Switchgrass Phyllosphere | LTSRRSVRPGLDNRFLLGGPSSGSRLPREVWAGWHHIGGQDVELTLYRRS |
| ⦗Top⦘ |