| Basic Information | |
|---|---|
| Taxon OID | 3300009980 Open in IMG/M |
| Scaffold ID | Ga0105135_118048 Open in IMG/M |
| Source Dataset Name | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 604 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated → Switchgrass Associated Microbial Communities From Austin, Texas, Usa, To Study Host-Microbe Interactions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Austin, Texas | |||||||
| Coordinates | Lat. (o) | 30.387 | Long. (o) | -97.7301 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024245 | Metagenome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105135_1180481 | F024245 | AGGAG | MFVAEKKDATLEAQSCALYAPRHPTLQWVTFGHGIARN |
| ⦗Top⦘ |