 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F024245 |
| Family Type | Metagenome |
| Number of Sequences | 206 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARNHPET |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 196 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 41.26 % |
| % of genes near scaffold ends (potentially truncated) | 95.63 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (57.282 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.922 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (83.981 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 57.28% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 17.96% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 8.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.97% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009977 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010276 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 15_59_3.3_214_A2 metaG | Engineered | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028246 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070666_109075341 | 3300005335 | Switchgrass Rhizosphere | MFVAKKQDATSEAQSGALYAPQNPISQRVRPGNGIERNHQET* |
| Ga0070666_109075342 | 3300005335 | Switchgrass Rhizosphere | MKKQDATSEAQSGALYAPQNPISQRVPPGNGIARNHPET* |
| Ga0070666_109075343 | 3300005335 | Switchgrass Rhizosphere | MLVAKKQDATSDAQSGALYAPQNPISQRVRPGNGIERNHKET* |
| Ga0070706_1011987711 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGKFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARYHPET* |
| Ga0070706_1011987712 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVDYKQDAISVAQSGALYAPQNPISQWVLPGNRIARNHPET* |
| Ga0070706_1011987713 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVAKKQDATSEAQSGALYAPQNPISQLVPPGNGIARNHAET* |
| Ga0068864_1026060181 | 3300005618 | Switchgrass Rhizosphere | VAKKQDATSEAQSGAFYAPQNPISQRVPPGNGITRNHPET* |
| Ga0068861_1023494771 | 3300005719 | Switchgrass Rhizosphere | KQVETSEAQSGAFYAPQNPISQQVPPGNGITRNHPET* |
| Ga0068863_1006860181 | 3300005841 | Switchgrass Rhizosphere | MFIAKKQDATSEAQSGAFYAPQNPISQRVPPGNGI |
| Ga0068863_1014878191 | 3300005841 | Switchgrass Rhizosphere | VVKKQDATSEAQSGALYAPQNPISQRVPPGYGIERNHPKT* |
| Ga0068858_1009433422 | 3300005842 | Switchgrass Rhizosphere | MFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIT* |
| Ga0068858_1018739691 | 3300005842 | Switchgrass Rhizosphere | GLGMFIAKKQDATSEAQSGAFYAPQNPISQLVPPGNEIARNHPET* |
| Ga0068860_1012883101 | 3300005843 | Switchgrass Rhizosphere | MFIAKKQDATSEAQSGALYAPQNPISQLVPPGYGIA |
| Ga0068860_1023904302 | 3300005843 | Switchgrass Rhizosphere | MFVAKKQDATSEAQSGAFYAPQSPISQLVPPGNEIAG |
| Ga0068862_1015462662 | 3300005844 | Switchgrass Rhizosphere | AKKQDATSEAQSGALYAPQNPISQQVPPGNRIARNHVET* |
| Ga0068862_1016049351 | 3300005844 | Switchgrass Rhizosphere | MFVAKKQDATSEAQSGALYAPQNPISQRVPPVNGIARNHLET* |
| Ga0068862_1016932972 | 3300005844 | Switchgrass Rhizosphere | SGLGKFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARYHPET* |
| Ga0105247_107435812 | 3300009101 | Switchgrass Rhizosphere | MFVAKKQDATSEAQSGALYAPQNLISQLVPPGNGIARN |
| Ga0105137_1085231 | 3300009972 | Switchgrass Associated | MFVAKKLDATSEAQSGAFYASQSPISQLVPPGMGIAETTQ |
| Ga0105129_1076572 | 3300009975 | Switchgrass Associated | MFVVKKQDATSEAQCGALYAPQNPISQWVPPSNRIARNH |
| Ga0105128_1136831 | 3300009976 | Switchgrass Associated | MFVAKKQDATSEAQSGAFYASQSPISQLVPPGKGIARNH |
| Ga0105128_1189671 | 3300009976 | Switchgrass Associated | LGMFVPKKQDATSEAQSGAFYASQSPISQLVPPGKGIARNHPET* |
| Ga0105141_1129901 | 3300009977 | Switchgrass Associated | MFVAKKQKETSEAQSGSFYAPQNPISQRVPPGNGIA |
| Ga0105135_1180481 | 3300009980 | Switchgrass Associated | MFVAEKKDATLEAQSCALYAPRHPTLQWVTFGHGIARN |
| Ga0105135_1198522 | 3300009980 | Switchgrass Associated | SGFGKFVEKKQDATSEAQSGAFYAPQNPISQLVPPGNGIAQNRPET* |
| Ga0105131_1346021 | 3300009989 | Switchgrass Associated | KKQDATSEAQSGAFYAPQNPISQLVPPGNGIERNHPETLF* |
| Ga0105131_1367761 | 3300009989 | Switchgrass Associated | MFVATKQDATSEAQSGAFYAPQNPISQLVPPGNGI |
| Ga0105132_1059471 | 3300009990 | Switchgrass Associated | KKQKETSEAQSGAFYAPQNPISQLVPPGNGIARNHPET* |
| Ga0105132_1445021 | 3300009990 | Switchgrass Associated | MFVAKKQDATSEAQSGALYAPQNPISQLVPPGNGIARNHPET* |
| Ga0105120_10212141 | 3300009992 | Switchgrass Associated | KKQDATFEAQSGAFYAPQNPISQLVPPGIGIARNHPETLFWA* |
| Ga0105120_10439431 | 3300009992 | Switchgrass Associated | MFGAKKQDATSEAQSGALYAPQNPISQRVPPGNGIARNH |
| Ga0105126_10255451 | 3300009994 | Switchgrass Associated | MFVAKKQEATSEAQSAAFYAPQSPISQLVPPGNEIARNQPET* |
| Ga0105126_10439991 | 3300009994 | Switchgrass Associated | LGMFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIVRNHPET* |
| Ga0105126_10493751 | 3300009994 | Switchgrass Associated | MFVAKKQKATMEAQSGALYAPQNPISQRVPPGNGIVRN |
| Ga0105126_10509141 | 3300009994 | Switchgrass Associated | GMFVAKKQDATSKAQSGALYAPQNPISQWVPPGNGIAKNHPET* |
| Ga0105139_10969151 | 3300009995 | Switchgrass Associated | MFVAKKQEATSEAQSGALYAPQNPISQRAPPGNGIVRNHLET* |
| Ga0134104_10821821 | 3300010276 | Switchgrass Degrading | MFVVKKQDATSEAESGSFYAPQNPISQLVPPGNGI |
| Ga0134104_10857121 | 3300010276 | Switchgrass Degrading | SGLGMFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARNHPET* |
| Ga0134125_108843241 | 3300010371 | Terrestrial Soil | MFVAKKQDATSESQSGALYAPQNPISQRVRPGYGIERNH |
| Ga0134125_117921881 | 3300010371 | Terrestrial Soil | ATLEAQSGAFYAPQNPISQLVPPGNGIAQNHPET* |
| Ga0134126_121067241 | 3300010396 | Terrestrial Soil | VAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIA* |
| Ga0134126_122820891 | 3300010396 | Terrestrial Soil | RSGLGLFVAKKQDATSEAQSGALYAPQNPISQRVPHVNGIARNHLET* |
| Ga0134126_124971591 | 3300010396 | Terrestrial Soil | MLVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIAR |
| Ga0134121_129333421 | 3300010401 | Terrestrial Soil | FVAKKQDATSEAQSGAFYAPQNPISQLVPPGNRIARNHPET* |
| Ga0134123_127461721 | 3300010403 | Terrestrial Soil | VAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARYHPET* |
| Ga0137776_14274081 | 3300010937 | Sediment | SGLGMLVAKKQDATSEAQSGALYAPQNPISQQVPPGNGIARNHPET* |
| Ga0137776_14274082 | 3300010937 | Sediment | MLVAKKQDETSEAQSGALYAPQNPISQRVPPGNRIARN |
| Ga0163163_130728812 | 3300014325 | Switchgrass Rhizosphere | MFVDYKQDATSVAQSGALYAPQNPISQRVPPGNGIARNHPET |
| Ga0157379_116484981 | 3300014968 | Switchgrass Rhizosphere | MFVAKKQDATSEAQSGAFYAPQSPISQLVPPGNEIAR |
| Ga0157379_118657491 | 3300014968 | Switchgrass Rhizosphere | LGKFDAKKQNATSEAQSGAFYAPQNPISQRGPPGKGI |
| Ga0157379_122515031 | 3300014968 | Switchgrass Rhizosphere | LGKFVAKKQEATSEAQSGAFYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182183_10718621 | 3300015270 | Switchgrass Phyllosphere | MFVAKKQDATLEAQSWALYAPQNPISQLVPPGNGIAQNHPET |
| Ga0182183_10876651 | 3300015270 | Switchgrass Phyllosphere | RSGLGMFVAKKQDATSEAQSGAMYVPQNPISQWVPPGNGIARNHPGT* |
| Ga0182102_10394241 | 3300015273 | Switchgrass Phyllosphere | KQDATSEAQSGAFYAPQNPISQLVPPGNGIARNQQET* |
| Ga0182099_10497501 | 3300015278 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGALYAPQNPITQRVPPGNGIA |
| Ga0182100_10307111 | 3300015280 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGALYAPQNPISQLVPPGNGIARN |
| Ga0182100_10955041 | 3300015280 | Switchgrass Phyllosphere | SGLGMFVAKKQDATSVAQSGALYAPQNPISQLVPPGNGIA* |
| Ga0182100_10992281 | 3300015280 | Switchgrass Phyllosphere | RSGLGKFVAKKQEATSEAQSGAFCAPQNPIAQLVPPSNGIARNHPET* |
| Ga0182101_10696851 | 3300015284 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182101_10696852 | 3300015284 | Switchgrass Phyllosphere | MFVAKKQVETSEAQSGAFYAPQNPISQRVPPGNGI |
| Ga0182101_10966922 | 3300015284 | Switchgrass Phyllosphere | MFVDYKQDATSVAQSGALYAPQNPISQWVPPGNGIVRN |
| Ga0182101_11006791 | 3300015284 | Switchgrass Phyllosphere | MFVAKKQDGTSVAQSGALYAPQNPISQRVPPGNGIARN |
| Ga0182103_10651792 | 3300015293 | Switchgrass Phyllosphere | GLGMFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARYHPET* |
| Ga0182104_10602891 | 3300015297 | Switchgrass Phyllosphere | SGLGMFVVKKQDATSEAQSGALYAPQNPIYQRVPHINGIAQNHPKT* |
| Ga0182104_11120751 | 3300015297 | Switchgrass Phyllosphere | GLGMFVAKKQYATSEAQSGALYAPQNTISQRVPPINGIARNHVET* |
| Ga0182184_10813761 | 3300015301 | Switchgrass Phyllosphere | VAKKQHATSEAQSGAFYAPQNPSSQRVPPGNGIARNHPENLFWA* |
| Ga0182098_11143791 | 3300015309 | Switchgrass Phyllosphere | GLGMFVAKKQDATSEAQSGALYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182162_11075562 | 3300015310 | Switchgrass Phyllosphere | MFVAKKQDATSEAQIGAFYAAQKRISQLLPPGNGIALNHPETLFWA* |
| Ga0182162_11169441 | 3300015310 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGALYAPQNPISQRVPPGNGIA |
| Ga0182182_10965821 | 3300015311 | Switchgrass Phyllosphere | VAKKQDATSEAQSGAFYAPQNPISQLVPPGNGITRKHPET* |
| Ga0182182_11133571 | 3300015311 | Switchgrass Phyllosphere | MFVVKKQYASSEAQSGALYAPQNPISQRVPPSNGIAR |
| Ga0182182_11163931 | 3300015311 | Switchgrass Phyllosphere | LGKFVAKKQEATSEAQSGAFYAPQNPISQLVPPGN |
| Ga0182168_10961701 | 3300015312 | Switchgrass Phyllosphere | MFVAKKQVETSEAQSGAFYAPQNPISQRVPPGNGITRN |
| Ga0182164_10664652 | 3300015313 | Switchgrass Phyllosphere | KKQDATSEAQSGALYAPQNPISQRVPPGNGIERNHQET* |
| Ga0182164_11105432 | 3300015313 | Switchgrass Phyllosphere | AKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARNHPETLFWA* |
| Ga0182164_11269591 | 3300015313 | Switchgrass Phyllosphere | QDATSEAQSGAFYAPQNPISQWVPPGNGIARNHPEN* |
| Ga0182120_10618191 | 3300015315 | Switchgrass Phyllosphere | LGMFVVKKQDATSEAQSGALYATQNPISQLVPPGNEIARNHPESLFWS* |
| Ga0182121_10900421 | 3300015316 | Switchgrass Phyllosphere | AKKQDATSEAQSGAFYAPQNPISQRVPPGNGIARNHPET* |
| Ga0182121_11022371 | 3300015316 | Switchgrass Phyllosphere | RSGLGMFVAKKQDATSEAQSGALYAPQNPISQRVPHVNGIARNHLET* |
| Ga0182121_11411261 | 3300015316 | Switchgrass Phyllosphere | FVAKKQDATSEAQSGALYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182121_11417481 | 3300015316 | Switchgrass Phyllosphere | MFVAKKQVETSEAQSGAFYAPQNPISQQVPPGNGITRNHPE |
| Ga0182136_10877281 | 3300015317 | Switchgrass Phyllosphere | VAKKQDATSKAQSGALYAPQNPISQRVPPGNGIA* |
| Ga0182136_11195301 | 3300015317 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGAFYAPQNPISQHVPPGNGIARN |
| Ga0182136_11272391 | 3300015317 | Switchgrass Phyllosphere | FGMFVAKKQDATSDAQSGAFYAPQNPISQRVPPGNGIARNHPET* |
| Ga0182181_11008171 | 3300015318 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGAFYAPQNPISQRVSHGNGIARN |
| Ga0182130_10742871 | 3300015319 | Switchgrass Phyllosphere | KKQDATSEAQSGAFYAPQNPISQLVPPGNGIARN* |
| Ga0182130_11209812 | 3300015319 | Switchgrass Phyllosphere | FVAKKQVETSKAQSGAFYAPQNPISQRVPPGNGITRNHPET* |
| Ga0182130_11374381 | 3300015319 | Switchgrass Phyllosphere | VVKKQDATSEAQSGAFYAPQSPISQPVPPGNEIARNHPET* |
| Ga0182165_10967841 | 3300015320 | Switchgrass Phyllosphere | AKKQDATSEAQSGAFYAPQNPISQRVPHSNGIERNHQET* |
| Ga0182165_11179892 | 3300015320 | Switchgrass Phyllosphere | MFIENKQDATSVAQSGALYAPLNPISQRVPPGNGIARNH |
| Ga0182165_11206321 | 3300015320 | Switchgrass Phyllosphere | KKQDATSEAQSVAFYAPQNPISQLVPPGYGIARNHPETLFWA* |
| Ga0182165_11313671 | 3300015320 | Switchgrass Phyllosphere | KKQDATLEAQSGALYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182134_11068001 | 3300015324 | Switchgrass Phyllosphere | SGLGMFVVKKQDATSEAQSGALYAPQNPISQLVPPGNGIERNHPKT* |
| Ga0182134_11172171 | 3300015324 | Switchgrass Phyllosphere | KFVAKKQEATSEAQSGAFYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182148_10830791 | 3300015325 | Switchgrass Phyllosphere | ATSEAQSGAFYAPQSPISQLVPPGNEIARNHPET* |
| Ga0182148_10878321 | 3300015325 | Switchgrass Phyllosphere | SGLGKFVAKKQDATSEAQSGALYVPQNPISQWVPPGNGNARNHPGT* |
| Ga0182148_11314601 | 3300015325 | Switchgrass Phyllosphere | VAKKQDATSDAQSGAFYAPQNPISQRVPPGNGIARNHPET* |
| Ga0182166_10536382 | 3300015326 | Switchgrass Phyllosphere | LGMFVAKKQDATSEAQSGAFYAPQNPISQRVPPGIGIARNHPET* |
| Ga0182166_11071811 | 3300015326 | Switchgrass Phyllosphere | VAKKQNATSKAQSGAFYAPQNPISQRVPPGNGIARNHPETLFWA* |
| Ga0182166_11071812 | 3300015326 | Switchgrass Phyllosphere | MFVEKKQDATSKAQSGALYAPQNPISQRVPPGNGI |
| Ga0182153_10833151 | 3300015328 | Switchgrass Phyllosphere | VAKKQVETLKAQSGAFYAPQNPISQRVPPGNRIARNHPET* |
| Ga0182135_11189641 | 3300015329 | Switchgrass Phyllosphere | VKKQGATSEAHSVAFYAPLIPISQLVPPDNGIARNPPETSFW |
| Ga0182135_11246701 | 3300015329 | Switchgrass Phyllosphere | LGKFVAKKQEATSEAQSGAFYAPQNPISQLVPPGNGIARNHLETEFWA* |
| Ga0182135_11509671 | 3300015329 | Switchgrass Phyllosphere | LGKFVAKKQDATSEAQSGAFYAPQNPISQRVPPGNGIAQNQPK |
| Ga0182135_11566671 | 3300015329 | Switchgrass Phyllosphere | RSGFGMFVAKKQDETSEAQSGAFYAPQNPISQRVPPGNGVARNHPETYF* |
| Ga0182152_11194761 | 3300015330 | Switchgrass Phyllosphere | KKQDATSEAQSGAFYAPQNPIPQRVPPGNGIARNHPEN* |
| Ga0182131_11087831 | 3300015331 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGAFYAPQNPISQRVPPGNGIA |
| Ga0182131_11100371 | 3300015331 | Switchgrass Phyllosphere | SGLGKFVAKKQDATSEAQSGAFYAPQNPISQRVPPGNGIAR* |
| Ga0182131_11434671 | 3300015331 | Switchgrass Phyllosphere | LGMFVAKKQDATSEAQSGALYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182117_11214171 | 3300015332 | Switchgrass Phyllosphere | RSGLGKFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNRIARNHPET* |
| Ga0182147_11346761 | 3300015333 | Switchgrass Phyllosphere | RNGLGMFVAKKQDATSEAQSGAFYAPQNPISQQVPPGNGITRKHIET* |
| Ga0182132_11366091 | 3300015334 | Switchgrass Phyllosphere | SGLGMFVAKKQDATSEAQSGALYAPQNLISQIVPPGNGIARNHPET* |
| Ga0182132_11375301 | 3300015334 | Switchgrass Phyllosphere | MFVATKQDATSEAQSGAFYAPQNPISQLVPPGNRIGRNHPE |
| Ga0182132_11467981 | 3300015334 | Switchgrass Phyllosphere | GMFVAKKQDATSEAQSGALYAPQNPISQRVPPGNEIERNHVETEFWA* |
| Ga0182116_10683441 | 3300015335 | Switchgrass Phyllosphere | RSGLGMFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNRIARNHPET* |
| Ga0182116_11060261 | 3300015335 | Switchgrass Phyllosphere | SGLGMFVAKKQDATSEAQSGALYAPQNPISQRVPPVNGIVRNHQET* |
| Ga0182116_11460081 | 3300015335 | Switchgrass Phyllosphere | GKFVAKKQEATSEAQSGAFYAPQNPISRLVPPGNGIARNHPET* |
| Ga0182116_11671231 | 3300015335 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGALYAPQNPISQLVPPGNGIAR |
| Ga0182116_11750911 | 3300015335 | Switchgrass Phyllosphere | GMFVAKKQDATSEAQSGALYAPQNPISQRVPPGNGIARNHP* |
| Ga0182150_10876171 | 3300015336 | Switchgrass Phyllosphere | KFVAKKQDATSEAQSGAFYAAQNPISQLVPPGNRIA* |
| Ga0182150_11474521 | 3300015336 | Switchgrass Phyllosphere | SGLGKIVAKKQDATSEAQSVAFYAPQNPISQRVPTGIGIARNHPET* |
| Ga0182151_11446071 | 3300015337 | Switchgrass Phyllosphere | GMFVAKKQDATSEAQSGALYARQNPISQRVPPGNGIARNHPETQFWA* |
| Ga0182151_11547181 | 3300015337 | Switchgrass Phyllosphere | RSGLGMFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIGGNNTET* |
| Ga0182151_11644881 | 3300015337 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGAFYAHQNPISQLVPPGNGIA* |
| Ga0182151_11666391 | 3300015337 | Switchgrass Phyllosphere | MFVAKKQKETSEAQSGAFYAPQNPISQRVPPGNGIARNH |
| Ga0182137_11590011 | 3300015338 | Switchgrass Phyllosphere | LGMFVAKKQDATSEAESGAFYAPQSPISQLVPPGNEIA* |
| Ga0182149_11509721 | 3300015339 | Switchgrass Phyllosphere | LGKFVAKKQEATSEAQSGAFYAPQNPISQLVPPGNGIARNH |
| Ga0182133_11011602 | 3300015340 | Switchgrass Phyllosphere | MFVENKQDTTSVAQSGALYAPQNPISQRVPPGNGITRNHPE |
| Ga0182133_11333801 | 3300015340 | Switchgrass Phyllosphere | MIVAKKQDATSEAQSGALYAPQNPISQRVPPGNGIARNH |
| Ga0182115_11680761 | 3300015348 | Switchgrass Phyllosphere | RSGLGKFVAKEQEATSEAQSGAFYAPQNPISQLVPPGNGIARNHPET* |
| Ga0182115_12109042 | 3300015348 | Switchgrass Phyllosphere | MFVVKKQDATSEAQNGALYAPQNAISQRVPPGNGIT |
| Ga0182115_12138081 | 3300015348 | Switchgrass Phyllosphere | MFVATKQDATSEAQSGAFYAPQTPISQIVPPGNGIARNHPETLFWA |
| Ga0182115_12275421 | 3300015348 | Switchgrass Phyllosphere | IAKKQVETSEAQSGAFYAPQNPISQRVPPGNGIARNHPET* |
| Ga0182115_12810061 | 3300015348 | Switchgrass Phyllosphere | RSGLGMLVAKKQNATSEAQSGAFYAPQNPISQLVPPGNGIARNHPES* |
| Ga0182115_12920191 | 3300015348 | Switchgrass Phyllosphere | AKKQDAASEAQSGAFYARLNPISQLVPPGNGIARNQPET* |
| Ga0182185_11623632 | 3300015349 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGALYAPQNPISQRVPPGNGITRN |
| Ga0182185_11867771 | 3300015349 | Switchgrass Phyllosphere | RSGLGKFVAKKQDVTSEAQSGAFYAPLNPISQLVPPGNGIVRNHPET* |
| Ga0182185_12101811 | 3300015349 | Switchgrass Phyllosphere | MFVAKKQDATLEAQSGAFYAPQNPISQLVPPGNGI |
| Ga0182185_12101812 | 3300015349 | Switchgrass Phyllosphere | SGLGMFVAKKQDATSEAQSGALYAPQNTISQRLPPGNEIARNHPET* |
| Ga0182185_12225551 | 3300015349 | Switchgrass Phyllosphere | KKQEATLEAQSGAFYAPQSPISQLVPPGNEIARNEPET* |
| Ga0182185_12487511 | 3300015349 | Switchgrass Phyllosphere | AKKQDATSEAQSGAFYAPQNPISQLVPPGKGIARNHPETLFWA* |
| Ga0182169_12811641 | 3300015352 | Switchgrass Phyllosphere | RSGLGMFVAKKQDATSEAQSGALYAPQNPISQRVPPGNGIVRNHPET* |
| Ga0182179_12446962 | 3300015353 | Switchgrass Phyllosphere | MFVAKKQDTTSVAQSGALYAPQNPISQLVPPGNGIA |
| Ga0182179_12555351 | 3300015353 | Switchgrass Phyllosphere | SGLGMIVAKKQDATSEAQSGAFYAPQNPISQWVPPGNGITRNHRETYFWA* |
| Ga0182179_12903201 | 3300015353 | Switchgrass Phyllosphere | MFVAKKQEATSEAQSGALYAAQNPISQQAPPGNGIVRNHPET* |
| Ga0182179_12967462 | 3300015353 | Switchgrass Phyllosphere | MFVVKKQEATSEAQCGALYAPQNPISQWVPPGNGIARNHPETLFWA* |
| Ga0182179_13261221 | 3300015353 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGALYAPQNPISKLVPPGNGIARNH |
| Ga0182167_11493442 | 3300015354 | Switchgrass Phyllosphere | FVAKKQDATSEAQIGAFYAPQNPISQLVPPGNGITRNHPETLFWA* |
| Ga0182167_11980321 | 3300015354 | Switchgrass Phyllosphere | MFVAKKQGATSEAQSGALYAPQNPISQRVPPGNGIT |
| Ga0182167_12885091 | 3300015354 | Switchgrass Phyllosphere | KFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGVARNHPET* |
| Ga0182167_12885092 | 3300015354 | Switchgrass Phyllosphere | MFVVKKQYASSEAQSGALYAPQNPISQRVPPSNRIARNH |
| Ga0182197_10669642 | 3300017408 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSGALYATQNPISQWVPPGKRIARNH |
| Ga0182197_11450741 | 3300017408 | Switchgrass Phyllosphere | MFVEKKQDTTSEAQSGAFYSPQNQISQLVPPGIGIARNH |
| Ga0182199_10769481 | 3300017412 | Switchgrass Phyllosphere | GMFVAKKQDATSVAQSGALYAPQNPISQRVPPGNGIARNHPET |
| Ga0182195_11664321 | 3300017414 | Switchgrass Phyllosphere | RSGLGMFVAKKQDATSEAQSGAFYAHQNPISQLVPPVNGIA |
| Ga0182213_12117551 | 3300017421 | Switchgrass Phyllosphere | SGLGMFVAKKQDATSEAQSGALYAPQNPISQRVPPGNGIARNHTET |
| Ga0182213_12440132 | 3300017421 | Switchgrass Phyllosphere | MFVVKKQDATSEAQSGALYAPQNPISQLVPPGNGIA |
| Ga0182201_11069621 | 3300017422 | Switchgrass Phyllosphere | MFVAKKQDATLEAQSGALYAPHNPISQLVPPGNGIARNHP |
| Ga0182196_10724071 | 3300017432 | Switchgrass Phyllosphere | RGLGKFVAKKQDATSEAQSGAFYAPQNPISQLVPPINGIAQNQPKT |
| Ga0182196_11109911 | 3300017432 | Switchgrass Phyllosphere | SSLRKQDATWEEQSGAFYAPQNQISQLVPPGNEIVRNHPET |
| Ga0182194_10449482 | 3300017435 | Switchgrass Phyllosphere | MFVAKKQVETSEAQSGAFYAPQNPISQRVPHGNGIARNHPE |
| Ga0182200_10610752 | 3300017439 | Switchgrass Phyllosphere | FVAKKQDATSEAQSGALYAPQNPISQRVPPGHLIGGNHPET |
| Ga0182214_10702391 | 3300017440 | Switchgrass Phyllosphere | KKKDATSDAQSGAFYAPQNPISQRVPPGNGIARNHPET |
| Ga0182214_11195141 | 3300017440 | Switchgrass Phyllosphere | VAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARYHPET |
| Ga0182214_11412881 | 3300017440 | Switchgrass Phyllosphere | MFVAKKQDATSEAQSRAFYAPQNPISQRVPPGNGITR |
| Ga0182198_11792671 | 3300017445 | Switchgrass Phyllosphere | MFIAKKQEATSEAQSGAFYAPQNPISQLVPPGNRIARNHPET |
| Ga0182216_11065582 | 3300017693 | Switchgrass Phyllosphere | VAKKQDATLDAQIGALYAPQNPISQRVRPGNGIERNHKET |
| Ga0182216_12022601 | 3300017693 | Switchgrass Phyllosphere | KKQDATSEAQSGAFYAPQNPISQLVPPGNEIVRNHPKT |
| Ga0182216_12209261 | 3300017693 | Switchgrass Phyllosphere | SGLGMFVAKKQDATSEAQSGALYAPQNPISQRVPTGNGIARNHVET |
| Ga0268322_10425831 | 3300028049 | Phyllosphere | RSGLGMFVAKKQDATSEAQSGALYATQNPISQLVPPGNGIA |
| Ga0268322_10505191 | 3300028049 | Phyllosphere | MFVVKKQDATSEAQNGALYAPQNAISQRVPPGNGIM |
| Ga0268328_10109351 | 3300028050 | Phyllosphere | MFVAKKQEATSEAQSDAFYAPQNPISQLVPPGNRIARNYPET |
| Ga0268328_10470091 | 3300028050 | Phyllosphere | VAKKQDATLEAQSGAFYAPQNPISQLVPPGNGIARNHPET |
| Ga0268330_10312881 | 3300028056 | Phyllosphere | MFVAKKQEATSEAQSGAFYAPQNPISQLVPPGNRI |
| Ga0268332_10227331 | 3300028058 | Phyllosphere | MFVVKKQDATSEAQSGALYAPQNPISQRVPPGNGIAR |
| Ga0268314_10475622 | 3300028061 | Phyllosphere | GLGMFVAKKQDATSEAQSGALYAPQNPISQRVRPGNGIERNHQET |
| Ga0268350_10705801 | 3300028063 | Phyllosphere | MFAAKKQDATSVAQSGALYAPQNPISQRVPPSNGIARNHP |
| Ga0268340_10175692 | 3300028064 | Phyllosphere | FVAKKQVETSEAQSGAFYAHQNPISQRVPPGNGITRNHPET |
| Ga0268340_10477642 | 3300028064 | Phyllosphere | MFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIA |
| Ga0268334_10049941 | 3300028140 | Phyllosphere | GLGMFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARYHPET |
| Ga0268334_10178911 | 3300028140 | Phyllosphere | MLVAKKQDATSEAQSGAFYAPQNLISQLVPPGNGIARNHPE |
| Ga0268326_10037241 | 3300028141 | Phyllosphere | GLGMFIAKKQDATSEAQSGALYAPQNPISQRVPPGNGIAQNHPET |
| Ga0268347_10283762 | 3300028142 | Phyllosphere | MFIVKKQDATSEAQSGALYAPQNPISQRVPPGNGITRNHPET |
| Ga0268348_10162781 | 3300028143 | Phyllosphere | MFVDYKQDATSVAQSGALYAPQNPISQWVPPGNGI |
| Ga0268348_10218062 | 3300028143 | Phyllosphere | LGMFVAKKQDATSEAQSGAFYAPQNPISQRVPPSNGIERNHPET |
| Ga0268345_10080993 | 3300028144 | Phyllosphere | SGLGKFVAKKQDATSEAQSGAFYARLNPISQLVPPDNGIARNHPET |
| Ga0268343_10020272 | 3300028150 | Phyllosphere | GLGMFVAKKQDATSEAQSGAFYAPQSPISQLVPPGNEIARNQPET |
| Ga0268343_10029552 | 3300028150 | Phyllosphere | MFVAKKQDVTSEAQSGAFYAPLNPISQLVPPGNGNARN |
| Ga0268343_10039811 | 3300028150 | Phyllosphere | MFIAKKQDATSEAQNGALYAPQNPISQRVPPGNGIARN |
| Ga0268320_10101922 | 3300028153 | Phyllosphere | SRSGLGMFVAKKQDATSEAQSGAFYASQSPISQLVPPGKGIA |
| Ga0268320_10224551 | 3300028153 | Phyllosphere | MFVAKKQDATSEAQSSAFYAPQNPISQHVPPGNGIT |
| Ga0268351_10301191 | 3300028246 | Phyllosphere | GKFVAKKQDTTSEAQSGAFYAPQNPISQLVPPGNGIARYHPET |
| Ga0268324_10079021 | 3300028251 | Phyllosphere | MFVVKKQDTTSEAQSGALYEPQNPISTRVPPGNGIERN |
| Ga0268324_10100441 | 3300028251 | Phyllosphere | GMFAAKKQDATSVAQSGALYAPQNPISQHVPPGNGIA |
| Ga0268316_10194672 | 3300028253 | Phyllosphere | SGLGVFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARNHPET |
| Ga0268310_10365392 | 3300028262 | Phyllosphere | LGLLVAKKQDATSEAQSGALYAPQNPISQRVPPGNGIERNHQET |
| Ga0268310_10422791 | 3300028262 | Phyllosphere | MFVAKRQDATSEAQSGALYAPQNPISPLVPPGNGIARNHPE |
| Ga0268317_10076561 | 3300028468 | Phyllosphere | VAKKQVETSEAQSGAFYAPQNPISQRVPPGNGITRNHPET |
| Ga0268317_10076562 | 3300028468 | Phyllosphere | MFVAKKQDATSEAQSGALYATQNPISQLVPPGNRIARNHPET |
| Ga0268337_10116681 | 3300028469 | Phyllosphere | MFVAKKQYATSEAQSGAFYAPQNPISQRVPPSNGIER |
| Ga0268323_10052512 | 3300028471 | Phyllosphere | MFVAKKQDATLEAQSGALYAPQNPISQLVPPGNEIARNHPE |
| Ga0268331_10259992 | 3300028474 | Phyllosphere | KFVAKKQDATSEAQSGAFYAPQNPISQLVPPGNGIARNHPETLF |
| Ga0268329_10149651 | 3300028476 | Phyllosphere | MFVAKKQDATSEAQSGALYATQNPISQLVPPGNRIA |
| Ga0268309_10132332 | 3300028477 | Phyllosphere | MFVAKKQDATSEAQSGALYAPQNLISQRVPPGNGI |
| Ga0268335_10057771 | 3300028527 | Phyllosphere | MFIAKKQDATSEAQSGALYAPQNPISQRVPPGNGI |
| Ga0268311_10144541 | 3300028529 | Phyllosphere | VAKKQDATSEAQSGALYAPQNPISQRVPPGNGIERNHQET |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |