Scaffold Ga0133747_10192

Overview

Basic Information

• Taxon OID: 3300009962
• Scaffold ID: Ga0133747_10192
• Source Dataset Name: Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Autonomous University of Barcelona
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3371
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain

Source Dataset Sampling Location

• Location Name: Alicante,Spain
• Coordinates
  • Lat. (^o): 38.3852246
  • Long. (^o): -0.5132249

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081456	Metagenome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0133747_101926	F081456	N/A	LGYRLFLEKGAHMFEEPPIYYILISFIFLIVFGSVAFATWLVWLTPISFMAKLVMTAIGFLLCAITVILYTISAE*