| Basic Information | |
|---|---|
| Taxon OID | 3300009960 Open in IMG/M |
| Scaffold ID | Ga0133744_10005 Open in IMG/M |
| Source Dataset Name | Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 13 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Autonomous University of Barcelona |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 43969 |
| Total Scaffold Genes | 58 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 51 (87.93%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alicante,Spain | |||||||
| Coordinates | Lat. (o) | 38.3852246 | Long. (o) | -0.5132249 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049707 | Metagenome | 146 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0133744_100058 | F049707 | AGGAG | VVSEYKSPHNDGHDPYILIWEYGNDIQRAEFVERWTDWDETGWTVWYFRLVGGGIMTFSTREWEQKDDVNHLTTIWMKPSLYDIERKTS* |
| ⦗Top⦘ |