NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133740_10012

Scaffold Ga0133740_10012


Overview

Basic Information
Taxon OID3300009954 Open in IMG/M
Scaffold IDGa0133740_10012 Open in IMG/M
Source Dataset NameHuman saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAutonomous University of Barcelona
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)29827
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (83.87%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain

Source Dataset Sampling Location
Location NameAlicante,Spain
CoordinatesLat. (o)38.3852246Long. (o)-0.5132249Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054110Metagenome140N

Sequences

Protein IDFamilyRBSSequence
Ga0133740_1001221F054110N/AVNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKPKQLYKKESEYSSTKQHEVLLFLVRTYKGGE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.