Basic Information | |
---|---|
Taxon OID | 3300009953 Open in IMG/M |
Scaffold ID | Ga0133737_10738 Open in IMG/M |
Source Dataset Name | Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Autonomous University of Barcelona |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1307 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alicante,Spain | |||||||
Coordinates | Lat. (o) | 38.3852246 | Long. (o) | -0.5132249 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105376 | Metagenome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133737_107381 | F105376 | N/A | PQFYFMNEKPEVSAKEFGALWANVEHIKESVDRHTTTLERIENIARANVTQAQLKTYIAEHEKESEEKYVKRTEIEGVMNFWSLVTSNLAKLFAIALVGLAIYATNNLIQQNKAVTELQEEVQQSQVRRK* |
⦗Top⦘ |