Scaffold Ga0132217_1208164

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0132217_1208164

Scaffold Ga0132217_1208164

Overview

Basic Information
Taxon OID	3300009942 Open in IMG/M
Scaffold ID	Ga0132217_1208164 Open in IMG/M
Source Dataset Name	Termite gut microbial communities - laboratory nest. Combined Assembly of 9 SPs
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Luxembourg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	836
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location
Location Name	France
Coordinates	Lat. (^o)	48.913957	Long. (^o)	2.485499	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081489	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0132217_12081641	F081489	N/A	MNAPISNPADCEVRGVIWFLQAANVRPSEFHRRFVAVYGEHVMNAASVRKWCIMFTNGRTDVHDAEKSGRPSVITDALKQKVNRIIRENRHFTISEVYEQCPEMSRTVVYEIVTEHLQYRKICERWAR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.