Scaffold Ga0132217_1001791

Overview

Basic Information

• Taxon OID: 3300009942
• Scaffold ID: Ga0132217_1001791
• Source Dataset Name: Termite gut microbial communities - laboratory nest. Combined Assembly of 9 SPs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Luxembourg
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2797
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (44.44%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Adephaga → Caraboidea → Carabidae → Trechinae → Trechini → Paraphaenops (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location

• Location Name: France
• Coordinates
  • Lat. (^o): 48.913957
  • Long. (^o): 2.485499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069311	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0132217_10017914	F069311	AGG	MLVMTVHIIKPVREIADRITAAVFFVVSFLLDFRFHFVSVFKIINLE*