NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0131092_10949163

Scaffold Ga0131092_10949163


Overview

Basic Information
Taxon OID3300009870 Open in IMG/M
Scaffold IDGa0131092_10949163 Open in IMG/M
Source Dataset NameActivated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Novogene Bioinformatics Technology Co., Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)701
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan

Source Dataset Sampling Location
Location NameTai Wan
CoordinatesLat. (o)25.0Long. (o)121.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009639Metagenome / Metatranscriptome315Y

Sequences

Protein IDFamilyRBSSequence
Ga0131092_109491631F009639N/AMRAWTVDADDIRVAEDFDAAVLHRTPEIEEFLSPGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.