Metagenome / Metatranscriptome Family F009639

Overview

Basic Information

• Family ID: F009639
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 315
• Average Sequence Length: 45 residues
• Representative Sequence: MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGT
• Number of Associated Samples: 237
• Number of Associated Scaffolds: 315

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 92.38 %
• % of genes near scaffold ends (potentially truncated): 99.68 %
• % of genes from short scaffolds (< 2000 bps): 90.48 %
• Associated GOLD sequencing projects: 226
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (89.206 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.571 % of family members)
• Environment Ontology (ENVO): Unclassified (36.190 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (41.270 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 16.44%
  β-sheet: 0.00%
  Coil/Unstructured: 83.56%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 315 Family Scaffolds
PF00296	Bac_luciferase	6.98
PF02446	Glyco_hydro_77	3.17
PF00441	Acyl-CoA_dh_1	2.22
PF01740	STAS	1.90
PF13458	Peripla_BP_6	1.90
PF04392	ABC_sub_bind	1.59
PF02518	HATPase_c	1.27
PF02515	CoA_transf_3	1.27
PF01566	Nramp	1.27
PF14031	D-ser_dehydrat	1.27
PF03372	Exo_endo_phos	0.95
PF01591	6PF2K	0.95
PF08020	DUF1706	0.95
PF08000	bPH_1	0.95
PF05088	Bac_GDH	0.95
PF01738	DLH	0.95
PF00072	Response_reg	0.95
PF13336	AcetylCoA_hyd_C	0.95
PF01557	FAA_hydrolase	0.95
PF13378	MR_MLE_C	0.95
PF02872	5_nucleotid_C	0.95
PF02627	CMD	0.95
PF02826	2-Hacid_dh_C	0.63
PF13365	Trypsin_2	0.63
PF03466	LysR_substrate	0.63
PF00266	Aminotran_5	0.63
PF13379	NMT1_2	0.63
PF15902	Sortilin-Vps10	0.63
PF13343	SBP_bac_6	0.63
PF04986	Y2_Tnp	0.63
PF00300	His_Phos_1	0.63
PF02770	Acyl-CoA_dh_M	0.63
PF00561	Abhydrolase_1	0.63
PF00043	GST_C	0.63
PF01764	Lipase_3	0.63
PF00005	ABC_tran	0.63
PF06808	DctM	0.63
PF13561	adh_short_C2	0.63
PF13442	Cytochrome_CBB3	0.32
PF12697	Abhydrolase_6	0.32
PF07690	MFS_1	0.32
PF07883	Cupin_2	0.32
PF12850	Metallophos_2	0.32
PF12276	DUF3617	0.32
PF13181	TPR_8	0.32
PF02811	PHP	0.32
PF12439	GDE_N	0.32
PF16868	NMT1_3	0.32
PF00486	Trans_reg_C	0.32
PF00903	Glyoxalase	0.32
PF01804	Penicil_amidase	0.32
PF02805	Ada_Zn_binding	0.32
PF12225	DUF5981	0.32
PF12973	Cupin_7	0.32
PF13185	GAF_2	0.32
PF00106	adh_short	0.32
PF02604	PhdYeFM_antitox	0.32
PF00496	SBP_bac_5	0.32
PF04228	Zn_peptidase	0.32
PF02538	Hydantoinase_B	0.32
PF09084	NMT1	0.32
PF01323	DSBA	0.32
PF00701	DHDPS	0.32
PF07730	HisKA_3	0.32
PF04186	FxsA	0.32
PF13538	UvrD_C_2	0.32
PF10518	TAT_signal	0.32
PF07366	SnoaL	0.32
PF02574	S-methyl_trans	0.32
PF14520	HHH_5	0.32
PF00582	Usp	0.32
PF00873	ACR_tran	0.32
PF03795	YCII	0.32
PF01569	PAP2	0.32
PF01636	APH	0.32
PF01717	Meth_synt_2	0.32
PF00211	Guanylate_cyc	0.32
PF00067	p450	0.32
PF00939	Na_sulph_symp	0.32
PF01833	TIG	0.32
PF09723	Zn-ribbon_8	0.32
PF07719	TPR_2	0.32
PF01553	Acyltransferase	0.32
PF00881	Nitroreductase	0.32
PF08241	Methyltransf_11	0.32
PF13366	PDDEXK_3	0.32
PF04366	Ysc84	0.32
PF04143	Sulf_transp	0.32
PF12399	BCA_ABC_TP_C	0.32
PF00114	Pilin	0.32
PF01817	CM_2	0.32
PF11745	DUF3304	0.32
PF07973	tRNA_SAD	0.32
PF10137	TIR-like	0.32
PF04828	GFA	0.32
PF00692	dUTPase	0.32
PF13683	rve_3	0.32
PF00487	FA_desaturase	0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 315 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	6.98
COG1640	4-alpha-glucanotransferase	Carbohydrate transport and metabolism [G]	3.17
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	2.86
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.59
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	1.27
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	1.27
COG2902	NAD-specific glutamate dehydrogenase	Amino acid transport and metabolism [E]	0.95
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.95
COG0737	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family	Defense mechanisms [V]	0.95
COG4283	Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domain	General function prediction only [R]	0.95
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.95
COG0625	Glutathione S-transferase	Posttranslational modification, protein turnover, chaperones [O]	0.63
COG0146	N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit	Amino acid transport and metabolism [E]	0.63
COG0435	Glutathionyl-hydroquinone reductase	Energy production and conversion [C]	0.63
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	0.63
COG2366	Acyl-homoserine lactone (AHL) acylase PvdQ	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.32
COG2391	Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains	General function prediction only [R]	0.32
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.32
COG4585	Signal transduction histidine kinase ComP	Signal transduction mechanisms [T]	0.32
COG3030	FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family	General function prediction only [R]	0.32
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	0.32
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.32
COG3850	Signal transduction histidine kinase NarQ, nitrate/nitrite-specific	Signal transduction mechanisms [T]	0.32
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.32
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.32
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.32
COG4564	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.32
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.32
COG2321	Predicted metalloprotease	General function prediction only [R]	0.32
COG2169	Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains	Replication, recombination and repair [L]	0.32
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.32
COG2124	Cytochrome P450	Defense mechanisms [V]	0.32
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.32
COG2040	Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)	Amino acid transport and metabolism [E]	0.32
COG1605	Chorismate mutase	Amino acid transport and metabolism [E]	0.32
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	0.32
COG1055	Na+/H+ antiporter NhaD or related arsenite permease	Inorganic ion transport and metabolism [P]	0.32
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	0.32
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	0.32
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.32
COG0646	Methionine synthase I (cobalamin-dependent), methyltransferase domain	Amino acid transport and metabolism [E]	0.32
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.32
COG0471	Di- and tricarboxylate antiporter	Carbohydrate transport and metabolism [G]	0.32

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.79 %
Unclassified	root	N/A	9.21 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.79 %
Unclassified	root	N/A	9.21 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	89.21 %
Unclassified	root	N/A	9.21 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.59 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	28.57 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	13.65 %
Unclassified	root	N/A	9.21 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.90 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.59 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.27 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.32 %

Level 5

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	16.83 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	13.65 %
Unclassified	root	N/A	9.21 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4.76 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.59 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.27 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.32 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.32 %
Holophagae	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.32 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.63 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.63 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.63 %

Level 6

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	13.65 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	12.06 %
Unclassified	root	N/A	9.21 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.90 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.59 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1.27 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.32 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.32 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	0.32 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.32 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.32 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	0.32 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.32 %
unclassified Holophagae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae	0.32 %
Moraxellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.63 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.63 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.63 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.63 %

Level 7

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	13.33 %
Unclassified	root	N/A	9.21 %
Sphaerotilaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.59 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1.27 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	1.27 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.32 %
Moraxellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.32 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.32 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.32 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.32 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.32 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	0.32 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.32 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
unclassified Chloroflexia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia	0.32 %
Usitatibacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.95 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 8

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.59 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1.27 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Rubrivivax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.32 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.32 %
Novispirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum	0.32 %
Fluviicoccus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Synechococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
unclassified Candidatus Accumulibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter	0.32 %
Usitatibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter	0.32 %
Massilia group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 9

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
unclassified Piscinibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.59 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	1.27 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Aldersonia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 10

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
unclassified Aldersonia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 11

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 12

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 13

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 14

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 15

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 16

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 17

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 18

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Palaeoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 19

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Ephemeroptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 20

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Furcatergalia	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 21

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Scapphodonta	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 22

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Ephemeridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 23

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Ephemera	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Level 24

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	13.33 %
Unclassified	root	N/A	9.21 %
Piscinibacter sp. HJYY11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	3.49 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.90 %
Ephemera danica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	1.59 %
Sphingomonas sp. 3P27F8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1.27 %
Aldersonia sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	0.32 %
Massilia eurypsychrophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	0.32 %
Novispirillum itersonii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	0.32 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.32 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.32 %
Roseomonas stagni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	0.32 %
Fluviicoccus keumensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	0.32 %
Candidatus Accumulibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	0.32 %
Usitatibacter rugosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	0.32 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.32 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.32 %
Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	0.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.32 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.32 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.32 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.32 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.32 %
Holophagae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	0.32 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	0.32 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.32 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.32 %
uncultured bacterium 888	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	0.32 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.95 %
Undibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	0.63 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.63 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2199352024|deeps__Contig_140510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1381
2199352024|deeps_contig94323.55736	All Organisms → cellular organisms → Bacteria	1234
3300000033|ICChiseqgaiiDRAFT_c0478262	All Organisms → cellular organisms → Bacteria	804
3300000364|INPhiseqgaiiFebDRAFT_100394304	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	861
3300000364|INPhiseqgaiiFebDRAFT_101823195	All Organisms → cellular organisms → Bacteria	3511
3300001431|F14TB_100706542	All Organisms → cellular organisms → Bacteria	1431
3300001431|F14TB_100898091	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1294
3300001431|F14TB_102522881	All Organisms → cellular organisms → Bacteria	568
3300003669|LSCM4E_1019157	Not Available	1189
3300004156|Ga0062589_102206761	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	564
3300004267|Ga0066396_10098101	All Organisms → cellular organisms → Bacteria	538
3300004463|Ga0063356_100071675	All Organisms → cellular organisms → Bacteria	3609
3300004633|Ga0066395_10294459	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	885
3300004633|Ga0066395_10357653	All Organisms → cellular organisms → Bacteria	813
3300004633|Ga0066395_10733233	All Organisms → cellular organisms → Bacteria	589
3300005093|Ga0062594_101315876	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	726
3300005171|Ga0066677_10205061	All Organisms → cellular organisms → Bacteria	1105
3300005171|Ga0066677_10319745	All Organisms → cellular organisms → Bacteria → Proteobacteria	888
3300005178|Ga0066688_10427482	All Organisms → cellular organisms → Bacteria	858
3300005289|Ga0065704_10313500	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	864
3300005294|Ga0065705_11091982	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	525
3300005331|Ga0070670_100384188	All Organisms → cellular organisms → Bacteria	1237
3300005332|Ga0066388_102019163	All Organisms → cellular organisms → Bacteria	1034
3300005332|Ga0066388_104282091	All Organisms → cellular organisms → Bacteria	727
3300005334|Ga0068869_100986296	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	733
3300005343|Ga0070687_100222623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1157
3300005353|Ga0070669_100177247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1665
3300005355|Ga0070671_100854233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	794
3300005364|Ga0070673_102060177	Not Available	542
3300005434|Ga0070709_11731331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	511
3300005436|Ga0070713_100455512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	1202
3300005439|Ga0070711_100319593	All Organisms → cellular organisms → Bacteria	1240
3300005440|Ga0070705_101123774	All Organisms → cellular organisms → Bacteria	644
3300005441|Ga0070700_100842811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	742
3300005468|Ga0070707_100524900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	1146
3300005468|Ga0070707_101009456	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	797
3300005546|Ga0070696_100343070	All Organisms → cellular organisms → Bacteria	1155
3300005563|Ga0068855_100864075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	958
3300005587|Ga0066654_10558791	Not Available	631
3300005616|Ga0068852_101890049	Not Available	619
3300005713|Ga0066905_100913939	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	769
3300005719|Ga0068861_100173862	All Organisms → cellular organisms → Bacteria	1787
3300005719|Ga0068861_100961686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	813
3300005719|Ga0068861_101189788	Not Available	737
3300005764|Ga0066903_100276409	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2627
3300005764|Ga0066903_100735462	All Organisms → cellular organisms → Bacteria	1748
3300005764|Ga0066903_101651180	All Organisms → cellular organisms → Bacteria	1218
3300005764|Ga0066903_102513459	All Organisms → cellular organisms → Bacteria	997
3300005764|Ga0066903_102782820	All Organisms → cellular organisms → Bacteria	949
3300005764|Ga0066903_106005403	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	636
3300005764|Ga0066903_107024338	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	584
3300005764|Ga0066903_108560963	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888	521
3300005836|Ga0074470_11618877	All Organisms → cellular organisms → Bacteria	1743
3300005841|Ga0068863_101005180	All Organisms → cellular organisms → Bacteria	837
3300005843|Ga0068860_100968762	All Organisms → cellular organisms → Bacteria	868
3300005843|Ga0068860_101552128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	684
3300005983|Ga0081540_1022607	All Organisms → cellular organisms → Bacteria	3710
3300006049|Ga0075417_10022318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni	2537
3300006050|Ga0075028_100163299	All Organisms → cellular organisms → Bacteria	1184
3300006059|Ga0075017_100451235	Not Available	971
3300006163|Ga0070715_10834607	Not Available	562
3300006173|Ga0070716_101317861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	584
3300006237|Ga0097621_101964300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	559
3300006358|Ga0068871_101935656	Not Available	561
3300006845|Ga0075421_100659900	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1221
3300006845|Ga0075421_100930043	All Organisms → cellular organisms → Bacteria	990
3300006846|Ga0075430_101352490	All Organisms → cellular organisms → Bacteria	586
3300006904|Ga0075424_100667716	All Organisms → cellular organisms → Bacteria	1110
3300006969|Ga0075419_10174522	All Organisms → cellular organisms → Bacteria	1415
3300009012|Ga0066710_102446347	All Organisms → cellular organisms → Bacteria	756
3300009082|Ga0105099_10360526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	861
3300009090|Ga0099827_10346225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium	1264
3300009094|Ga0111539_10218689	Not Available	2219
3300009095|Ga0079224_101948181	Not Available	834
3300009100|Ga0075418_11938021	Not Available	641
3300009101|Ga0105247_10963775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	663
3300009143|Ga0099792_10915280	All Organisms → cellular organisms → Bacteria	581
3300009148|Ga0105243_10343867	All Organisms → cellular organisms → Bacteria	1367
3300009148|Ga0105243_10999058	All Organisms → cellular organisms → Bacteria → Proteobacteria	839
3300009148|Ga0105243_12756654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	532
3300009156|Ga0111538_10413294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	1709
3300009157|Ga0105092_10721818	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	581
3300009162|Ga0075423_10585956	All Organisms → cellular organisms → Bacteria	1175
3300009171|Ga0105101_10659397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	521
3300009176|Ga0105242_10763876	All Organisms → cellular organisms → Bacteria	953
3300009177|Ga0105248_10175079	All Organisms → cellular organisms → Bacteria	2419
3300009177|Ga0105248_10193274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2293
3300009177|Ga0105248_11213466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	853
3300009822|Ga0105066_1085887	All Organisms → cellular organisms → Bacteria	685
3300009870|Ga0131092_10949163	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	701
3300010029|Ga0105074_1073648	All Organisms → cellular organisms → Bacteria	623
3300010046|Ga0126384_12105162	All Organisms → cellular organisms → Bacteria	541
3300010046|Ga0126384_12195661	All Organisms → cellular organisms → Bacteria	531
3300010047|Ga0126382_10265138	All Organisms → cellular organisms → Bacteria	1268
3300010358|Ga0126370_10617094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	939
3300010358|Ga0126370_11352116	Not Available	670
3300010358|Ga0126370_11405575	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	659
3300010359|Ga0126376_10103091	All Organisms → cellular organisms → Bacteria	2181
3300010359|Ga0126376_10922577	All Organisms → cellular organisms → Bacteria	866
3300010360|Ga0126372_11475542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	715
3300010360|Ga0126372_11605173	All Organisms → cellular organisms → Bacteria	689
3300010360|Ga0126372_13102603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	516
3300010361|Ga0126378_12954031	Not Available	542
3300010362|Ga0126377_10068076	All Organisms → cellular organisms → Bacteria	3159
3300010366|Ga0126379_10641903	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1151
3300010366|Ga0126379_11877223	All Organisms → cellular organisms → Bacteria	703
3300010366|Ga0126379_12044852	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	675
3300010366|Ga0126379_12223796	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	649
3300010373|Ga0134128_11823996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus	669
3300010397|Ga0134124_10255834	All Organisms → cellular organisms → Bacteria	1613
3300010398|Ga0126383_11840261	All Organisms → cellular organisms → Bacteria	694
3300010398|Ga0126383_12055201	All Organisms → cellular organisms → Bacteria	659
3300010399|Ga0134127_12188812	All Organisms → cellular organisms → Bacteria	632
3300010400|Ga0134122_11547368	All Organisms → cellular organisms → Bacteria	685
3300010401|Ga0134121_11262492	All Organisms → cellular organisms → Bacteria	742
3300010430|Ga0118733_108767108	All Organisms → cellular organisms → Bacteria	522
3300011119|Ga0105246_12348114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	522
3300011270|Ga0137391_11010536	All Organisms → cellular organisms → Bacteria	676
3300012200|Ga0137382_10238184	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1259
3300012202|Ga0137363_10513787	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1007
3300012351|Ga0137386_10473012	All Organisms → cellular organisms → Bacteria	903
3300012353|Ga0137367_10170134	All Organisms → cellular organisms → Bacteria	1585
3300012355|Ga0137369_10079810	All Organisms → cellular organisms → Bacteria	2747
3300012357|Ga0137384_10149274	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1956
3300012360|Ga0137375_10267029	All Organisms → cellular organisms → Bacteria	1569
3300012362|Ga0137361_10710856	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	917
3300012487|Ga0157321_1018305	All Organisms → cellular organisms → Bacteria	619
3300012582|Ga0137358_10368569	All Organisms → cellular organisms → Bacteria → Proteobacteria	972
3300012582|Ga0137358_10582680	All Organisms → cellular organisms → Bacteria	751
3300012900|Ga0157292_10321011	All Organisms → cellular organisms → Bacteria → Proteobacteria	563
3300012922|Ga0137394_10223523	All Organisms → cellular organisms → Bacteria	1610
3300012922|Ga0137394_11066069	All Organisms → cellular organisms → Bacteria	670
3300012923|Ga0137359_10502744	Not Available	1069
3300012929|Ga0137404_10933297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40	792
3300012948|Ga0126375_10552181	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	870
3300012948|Ga0126375_11386487	All Organisms → cellular organisms → Bacteria	595
3300012971|Ga0126369_12094902	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	653
3300012971|Ga0126369_12222950	All Organisms → cellular organisms → Bacteria	636
3300012971|Ga0126369_12243583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	633
3300012971|Ga0126369_13398466	All Organisms → cellular organisms → Bacteria	521
3300012989|Ga0164305_10549074	Not Available	919
3300013102|Ga0157371_10139646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1726
3300013105|Ga0157369_10888148	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	914
3300013297|Ga0157378_11715823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	675
3300013307|Ga0157372_10024769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	6521
3300013307|Ga0157372_10192926	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2359
3300013307|Ga0157372_11291076	Not Available	842
3300014325|Ga0163163_11457383	All Organisms → cellular organisms → Bacteria	746
3300014325|Ga0163163_11509248	All Organisms → cellular organisms → Bacteria	733
3300014326|Ga0157380_10600775	All Organisms → cellular organisms → Bacteria	1088
3300014326|Ga0157380_13549679	All Organisms → cellular organisms → Bacteria	500
3300014502|Ga0182021_11238941	All Organisms → cellular organisms → Bacteria	899
3300014968|Ga0157379_10611382	All Organisms → cellular organisms → Bacteria	1018
3300014968|Ga0157379_11784295	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	604
3300015241|Ga0137418_10304570	All Organisms → cellular organisms → Bacteria	1331
3300015371|Ga0132258_10517254	All Organisms → cellular organisms → Bacteria → Proteobacteria	2987
3300015371|Ga0132258_10663062	All Organisms → cellular organisms → Bacteria	2624
3300015371|Ga0132258_13147992	All Organisms → cellular organisms → Bacteria	1140
3300015372|Ga0132256_101293199	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	842
3300015372|Ga0132256_101934463	All Organisms → cellular organisms → Bacteria	697
3300015373|Ga0132257_101365716	All Organisms → cellular organisms → Bacteria	901
3300015373|Ga0132257_101840155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	778
3300015373|Ga0132257_102643976	All Organisms → cellular organisms → Bacteria → Proteobacteria	653
3300015373|Ga0132257_104251493	All Organisms → cellular organisms → Bacteria	521
3300015374|Ga0132255_102486926	All Organisms → cellular organisms → Bacteria	791
3300015374|Ga0132255_106015113	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	513
3300016341|Ga0182035_10684170	All Organisms → cellular organisms → Bacteria	892
3300016341|Ga0182035_10907999	All Organisms → cellular organisms → Bacteria → Proteobacteria	777
3300016371|Ga0182034_10740309	All Organisms → cellular organisms → Bacteria	838
3300016422|Ga0182039_10296585	All Organisms → cellular organisms → Bacteria	1338
3300017792|Ga0163161_10021611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4522
3300017965|Ga0190266_10288574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	848
3300017965|Ga0190266_11342153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	505
3300018000|Ga0184604_10345585	All Organisms → cellular organisms → Bacteria	529
3300018058|Ga0187766_10891735	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	627
3300018060|Ga0187765_10516412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii	758
3300018071|Ga0184618_10043631	All Organisms → cellular organisms → Bacteria	1603
3300018084|Ga0184629_10033989	Not Available	2228
3300018084|Ga0184629_10692848	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.	513
3300019879|Ga0193723_1105564	All Organisms → cellular organisms → Bacteria	792
3300020082|Ga0206353_11841651	All Organisms → cellular organisms → Bacteria → Proteobacteria	1654
3300020596|Ga0163149_10472233	All Organisms → cellular organisms → Bacteria	636
3300021082|Ga0210380_10265533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	779
3300021088|Ga0210404_10694285	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	580
3300021168|Ga0210406_11213319	All Organisms → cellular organisms → Bacteria	548
3300021170|Ga0210400_10021730	All Organisms → cellular organisms → Bacteria	5006
3300021403|Ga0210397_11197869	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	590
3300021445|Ga0182009_10168355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	1051
3300021474|Ga0210390_10674075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	863
3300021560|Ga0126371_10590251	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1260
3300021560|Ga0126371_12920458	All Organisms → cellular organisms → Bacteria	579
3300022694|Ga0222623_10226029	All Organisms → cellular organisms → Bacteria	724
3300023261|Ga0247796_1047412	All Organisms → cellular organisms → Bacteria	740
3300024056|Ga0124853_1160109	All Organisms → cellular organisms → Bacteria	2176
3300025321|Ga0207656_10633540	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	546
3300025907|Ga0207645_11086818	Not Available	540
3300025912|Ga0207707_10724470	All Organisms → cellular organisms → Bacteria → Proteobacteria	834
3300025916|Ga0207663_10998452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	671
3300025916|Ga0207663_11038088	All Organisms → cellular organisms → Bacteria	658
3300025917|Ga0207660_11724156	All Organisms → cellular organisms → Bacteria	503
3300025920|Ga0207649_10828731	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	723
3300025920|Ga0207649_11472473	All Organisms → cellular organisms → Bacteria	539
3300025923|Ga0207681_10620185	All Organisms → cellular organisms → Bacteria	895
3300025924|Ga0207694_10120532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2094
3300025930|Ga0207701_11434694	All Organisms → cellular organisms → Bacteria	561
3300025931|Ga0207644_10779269	All Organisms → cellular organisms → Bacteria	799
3300025933|Ga0207706_10345023	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1295
3300025935|Ga0207709_10500841	All Organisms → cellular organisms → Bacteria	948
3300025938|Ga0207704_10801476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	786
3300025941|Ga0207711_10122165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2326
3300025941|Ga0207711_10387604	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1297
3300025941|Ga0207711_11769747	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	561
3300025945|Ga0207679_11364157	Not Available	651
3300025981|Ga0207640_11370940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	633
3300025986|Ga0207658_10018172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4851
3300025986|Ga0207658_10371189	All Organisms → cellular organisms → Bacteria	1251
3300026023|Ga0207677_10032884	All Organisms → cellular organisms → Bacteria	3339
3300026023|Ga0207677_12232554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8	509
3300026088|Ga0207641_10151967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2097
3300026088|Ga0207641_10864908	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	897
3300026088|Ga0207641_12260417	Not Available	544
3300026116|Ga0207674_11052673	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	783
3300026121|Ga0207683_10141671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2167
3300026121|Ga0207683_10900199	All Organisms → cellular organisms → Bacteria → Acidobacteria	822
3300026142|Ga0207698_10378974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1345
3300026142|Ga0207698_11349967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	728
3300026342|Ga0209057_1232647	All Organisms → cellular organisms → Bacteria	523
3300026354|Ga0257180_1005857	Not Available	1352
3300026369|Ga0257152_1029386	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	591
3300026489|Ga0257160_1035976	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	830
3300026538|Ga0209056_10083586	All Organisms → cellular organisms → Bacteria	2681
3300027169|Ga0209897_1006077	All Organisms → cellular organisms → Bacteria	1566
3300027384|Ga0209854_1022146	All Organisms → cellular organisms → Bacteria	1034
3300027577|Ga0209874_1011622	All Organisms → cellular organisms → Bacteria	2576
3300027654|Ga0209799_1139332	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	552
3300027727|Ga0209328_10160192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	683
3300027775|Ga0209177_10157695	All Organisms → cellular organisms → Bacteria	776
3300027846|Ga0209180_10615585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.	599
3300027899|Ga0209668_10118330	Not Available	1567
3300027909|Ga0209382_10540346	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1278
3300027910|Ga0209583_10000056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	34920
(restricted) 3300028043|Ga0233417_10639213	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	509
3300028790|Ga0307283_10191177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	582
3300028870|Ga0302254_10108514	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1015
3300028878|Ga0307278_10359343	All Organisms → cellular organisms → Bacteria	642
3300029907|Ga0311329_10611337	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	721
3300029987|Ga0311334_11843695	All Organisms → cellular organisms → Bacteria	516
3300029989|Ga0311365_11852932	All Organisms → cellular organisms → Bacteria → Proteobacteria	516
3300029990|Ga0311336_10249961	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1456
3300030019|Ga0311348_10289254	Not Available	1222
3300030339|Ga0311360_10843452	Not Available	727
3300030838|Ga0311335_10666265	Not Available	731
3300031231|Ga0170824_117268238	Not Available	711
3300031232|Ga0302323_100419068	All Organisms → cellular organisms → Bacteria	1419
3300031232|Ga0302323_103049371	All Organisms → cellular organisms → Bacteria → Proteobacteria	534
3300031562|Ga0310886_10384687	Not Available	824
3300031640|Ga0318555_10215903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1035
3300031640|Ga0318555_10399247	All Organisms → cellular organisms → Bacteria	745
3300031716|Ga0310813_12001217	All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium	546
3300031720|Ga0307469_11791370	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	593
3300031726|Ga0302321_102847692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila	565
3300031730|Ga0307516_10367790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1101
3300031731|Ga0307405_10260513	All Organisms → cellular organisms → Bacteria → Proteobacteria	1295
3300031740|Ga0307468_100690139	All Organisms → cellular organisms → Bacteria	851
3300031740|Ga0307468_100909948	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	764
3300031740|Ga0307468_101029227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	727
3300031740|Ga0307468_101612644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis	607
3300031770|Ga0318521_10454270	All Organisms → cellular organisms → Bacteria	767
3300031792|Ga0318529_10455322	All Organisms → cellular organisms → Bacteria	595
3300031819|Ga0318568_10523144	All Organisms → cellular organisms → Bacteria	740
3300031820|Ga0307473_10055748	All Organisms → cellular organisms → Bacteria	1901
3300031820|Ga0307473_10133490	All Organisms → cellular organisms → Bacteria	1384
3300031820|Ga0307473_11033978	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	602
3300031824|Ga0307413_11281990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	640
3300031897|Ga0318520_10512434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	741
3300031903|Ga0307407_11410195	All Organisms → cellular organisms → Bacteria	549
3300031912|Ga0306921_11294665	All Organisms → cellular organisms → Bacteria	807
3300031941|Ga0310912_10893570	All Organisms → cellular organisms → Bacteria → Proteobacteria	684
3300031943|Ga0310885_10918478	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	502
3300031995|Ga0307409_100999766	All Organisms → cellular organisms → Bacteria	854
3300031996|Ga0308176_12551682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	545
3300032002|Ga0307416_100322267	All Organisms → cellular organisms → Bacteria → Proteobacteria	1548
3300032004|Ga0307414_11142620	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	720
3300032005|Ga0307411_10614649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	936
3300032008|Ga0318562_10439224	All Organisms → cellular organisms → Bacteria	758
3300032009|Ga0318563_10279947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	902
3300032025|Ga0318507_10442751	All Organisms → cellular organisms → Bacteria	566
3300032064|Ga0318510_10507657	All Organisms → cellular organisms → Bacteria	522
3300032068|Ga0318553_10542489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	609
3300032074|Ga0308173_11334514	All Organisms → cellular organisms → Bacteria	672
3300032074|Ga0308173_11600713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11	613
3300032143|Ga0315292_11713095	All Organisms → cellular organisms → Bacteria	504
3300032144|Ga0315910_11614994	All Organisms → cellular organisms → Bacteria	506
3300032180|Ga0307471_100453662	All Organisms → cellular organisms → Bacteria	1422
3300032205|Ga0307472_102533540	All Organisms → cellular organisms → Bacteria	522
3300032256|Ga0315271_10821465	All Organisms → cellular organisms → Bacteria	801
3300032261|Ga0306920_101075522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1168
3300032782|Ga0335082_10284160	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1530
3300032782|Ga0335082_10446653	All Organisms → cellular organisms → Bacteria	1156
3300032782|Ga0335082_11125755	Not Available	651
3300032829|Ga0335070_10344007	All Organisms → cellular organisms → Bacteria	1436
3300032893|Ga0335069_12098821	All Organisms → cellular organisms → Bacteria	593
3300033289|Ga0310914_10306812	All Organisms → cellular organisms → Bacteria	1432
3300033406|Ga0316604_10238296	All Organisms → cellular organisms → Bacteria	986
3300033407|Ga0214472_11478492	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	582
3300033418|Ga0316625_100308005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1133
3300033418|Ga0316625_101437099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	648
3300033434|Ga0316613_10053736	All Organisms → cellular organisms → Bacteria → Proteobacteria	2335
3300033481|Ga0316600_10050804	All Organisms → cellular organisms → Bacteria → Proteobacteria	2329
3300033482|Ga0316627_101466678	Not Available	688
3300033482|Ga0316627_101638755	All Organisms → cellular organisms → Bacteria → Proteobacteria	656
3300033488|Ga0316621_11212090	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	571
3300033551|Ga0247830_11733863	All Organisms → cellular organisms → Bacteria	501
3300034147|Ga0364925_0404328	All Organisms → cellular organisms → Bacteria	518
3300034160|Ga0370510_0126372	All Organisms → cellular organisms → Bacteria	781

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	68.57%
Host-Associated	Host-Associated	31.11%
Engineered	Engineered	0.32%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.90%
Plants	Host-Associated → Plants	31.11%
Aquatic	Environmental → Aquatic	6.67%
Wastewater	Engineered → Wastewater	0.32%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	58.10%
Rhizosphere	Host-Associated → Plants → Rhizosphere	18.10%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.43%
Freshwater	Environmental → Aquatic → Freshwater	3.49%
Peat	Environmental → Terrestrial → Peat	3.49%
Sediment	Environmental → Aquatic → Sediment	2.86%
Roots	Host-Associated → Plants → Roots	1.59%
Marine	Environmental → Aquatic → Marine	0.32%
Floodplain	Environmental → Terrestrial → Floodplain	0.32%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.32%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.37%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.33%
Loam	Environmental → Terrestrial → Soil → Loam	11.75%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.62%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.40%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.76%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.49%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.86%
Sand	Environmental → Terrestrial → Soil → Sand	1.59%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.27%
Lake	Environmental → Aquatic → Freshwater → Lake	1.27%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.27%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.63%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.32%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.32%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.32%
Coastal	Environmental → Aquatic → Marine → Coastal	0.32%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.32%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.32%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.32%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.95%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.33%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.62%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.40%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.08%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.76%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.49%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.86%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.86%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.90%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.59%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.59%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.27%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.27%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.27%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.63%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.32%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.32%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.32%
Coalbed Water	Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water	0.32%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.32%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.32%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.32%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.32%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.32%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.32%

Habitat

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.67%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.03%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.08%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.13%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.81%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.49%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.86%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	2.86%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.22%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.22%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.90%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.59%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.59%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.59%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.27%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.27%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.27%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.95%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.95%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.63%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.63%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.63%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.63%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.63%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.32%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.32%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	0.32%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.32%
Coalbed Water	Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water	0.32%
Marine Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment	0.32%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.32%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.32%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil	0.32%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.32%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.32%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.32%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.32%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.32%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.32%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.32%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.32%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.32%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.32%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.32%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.32%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.32%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.32%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.32%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.32%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.32%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.32%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
2199352024	Bare-fallow DEEP SOIL	Environmental
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental
3300003669	Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Early Sample 3)	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009095	Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015	Environmental
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009822	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40	Environmental
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered
3300010029	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010430	Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental
3300012487	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510	Host-Associated
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental
3300012900	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1	Environmental
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015372	Soil combined assembly	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental
3300020596	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1	Environmental
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300021474	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental
3300023261	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6	Environmental
3300024056	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)	Environmental
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300026342	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)	Environmental
3300026354	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B	Environmental
3300026369	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A	Environmental
3300026489	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A	Environmental
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental
3300027169	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes)	Environmental
3300027384	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)	Environmental
3300027577	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)	Environmental
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental
3300028043 (restricted)	Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG	Environmental
3300028790	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122	Environmental
3300028870	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4	Environmental
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental
3300029907	I_Bog_N1 coassembly	Environmental
3300029987	I_Fen_E3 coassembly	Environmental
3300029989	III_Fen_N1 coassembly	Environmental
3300029990	I_Fen_N2 coassembly	Environmental
3300030019	II_Fen_E2 coassembly	Environmental
3300030339	III_Bog_N1 coassembly	Environmental
3300030838	I_Fen_N1 coassembly	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental
3300032025	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20	Environmental
3300032064	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17	Environmental
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental
3300033406	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT	Environmental
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental
3300033434	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b	Environmental
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental
3300034147	Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17	Environmental
3300034160	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_02566990	2199352024	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIIIGTKGFGKT
deeps_00784720	2199352024	Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDAFLNSSRDDKFVVIGTKGFGK
ICChiseqgaiiDRAFT_04782623	3300000033	Soil	MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLGLDRDDKFI
INPhiseqgaiiFebDRAFT_1003943041	3300000364	Soil	MRAWTVDADDIRVAEXFDEALLHRTPEIDSFLRQDRDDKFIVSATKG
INPhiseqgaiiFebDRAFT_1018231954	3300000364	Soil	MRAWTVDADDIRVAEDFDDALLHRTPEIDAFLNLDRDDKFIVIGTKGFGKTLLLK
F14TB_1007065421	3300001431	Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGKT
F14TB_1008980911	3300001431	Soil	MRAWTVDADDIRVAEDFNESLLHHTPEIDGFLRSDRD
F14TB_1025228811	3300001431	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLNLDRDDKFIVIGTKGFGKT
LSCM4E_10191572	3300003669	Coalbed Water	MRAWTVDADDIRVAEDFDAALLHRTPEIEEFLSHGGEKFVVIGTKGFGKTLLLKAKRVLTQRGG
Ga0062589_1022067611	3300004156	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKTLL
Ga0066396_100981012	3300004267	Tropical Forest Soil	MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTK
Ga0063356_1000716751	3300004463	Arabidopsis Thaliana Rhizosphere	MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIGTKGFGKTLL
Ga0066395_102944592	3300004633	Tropical Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIAT
Ga0066395_103576531	3300004633	Tropical Forest Soil	MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTKGFG
Ga0066395_107332331	3300004633	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVI
Ga0062594_1013158762	3300005093	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRQDRDDKFIVIATKG
Ga0066677_102050612	3300005171	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKT
Ga0066677_103197451	3300005171	Soil	MRAWTVDADDIRVAEDFNDSLLHRTPEIDGFLRSDRDDKFIVIGTKGFGK
Ga0066688_104274822	3300005178	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVI
Ga0065704_103135001	3300005289	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLRPDRDDKFIVIGTKGFGKTL
Ga0065705_110919821	3300005294	Switchgrass Rhizosphere	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTK
Ga0070670_1003841881	3300005331	Switchgrass Rhizosphere	MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGK
Ga0066388_1020191632	3300005332	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLLLKA
Ga0066388_1042820911	3300005332	Tropical Forest Soil	MRAWTVDADDIRVVEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLLLKA
Ga0068869_1009862962	3300005334	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRPDRDDKFIVIGTKGFGKTLL
Ga0070687_1002226231	3300005343	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPARDDKFIVIATKGF
Ga0070669_1001772473	3300005353	Switchgrass Rhizosphere	MLVASSAGGERMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDD
Ga0070671_1008542332	3300005355	Switchgrass Rhizosphere	MLVAIECPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLL
Ga0070673_1020601771	3300005364	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFNESLLHRTPEIDAFLRSDRDDKFI
Ga0070709_117313312	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDKFIVIGTK
Ga0070713_1004555122	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVEEDFDDSLLHRTPEISAFLRPDRDDKFIVIGT
Ga0070711_1003195932	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATK
Ga0070705_1011237741	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVAEDLDQSLLHRTPEIDDFLSPGGEKFVVIGTKG
Ga0070700_1008428112	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFG
Ga0070707_1005249002	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIATKG
Ga0070707_1010094562	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKF
Ga0070696_1003430702	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGKTL
Ga0068855_1008640752	3300005563	Corn Rhizosphere	MRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDK
Ga0066654_105587912	3300005587	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTAHRDDKFIVIGTKGF
Ga0068852_1018900492	3300005616	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDDFLRSDRDDK
Ga0066905_1009139392	3300005713	Tropical Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLNPDRDDKFIVIGTKGFGKTL
Ga0068861_1001738621	3300005719	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGT
Ga0068861_1009616861	3300005719	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKGFGKTL
Ga0068861_1011897881	3300005719	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLERDDKFIVIGTKGF
Ga0066903_1002764097	3300005764	Tropical Forest Soil	MRPWTVDADDIRAADDFDETLLHRTPEIDAFLAPDR
Ga0066903_1007354621	3300005764	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDALLHRTPEIDAFLSVDRDDKFVVIGTKGFGKTLLL
Ga0066903_1016511803	3300005764	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL
Ga0066903_1025134591	3300005764	Tropical Forest Soil	MRPWTVDADDIRAADDFDETLLHRTPEIDAFLAPDRDDKFIVIGTKG
Ga0066903_1027828203	3300005764	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIG
Ga0066903_1060054031	3300005764	Tropical Forest Soil	MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTKGFGKT
Ga0066903_1070243381	3300005764	Tropical Forest Soil	MRAWTVDADDIRVAADFDDALLHRTPEIDSFLSLERDDKFIVIGTKGFGKTL
Ga0066903_1085609632	3300005764	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHHTPEIDSFLAADRDD
Ga0074470_116188771	3300005836	Sediment (Intertidal)	MRAWTVDADDIRVAEDFTESLLHRTPEIEAFLRSD
Ga0068863_1010051801	3300005841	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL
Ga0068860_1009687623	3300005843	Switchgrass Rhizosphere	MRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKT
Ga0068860_1015521283	3300005843	Switchgrass Rhizosphere	MRAWTVDADDIRVADDFDESLLHRTPEIDGFLTPARHDKFIVIGTKG
Ga0081540_10226073	3300005983	Tabebuia Heterophylla Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRD
Ga0075417_100223181	3300006049	Populus Rhizosphere	MRAWTVDADEIRVAEDLDETLLHRTPEIDSFLSLKRDDKF
Ga0075028_1001632991	3300006050	Watersheds	MRAWTVDADDIQVAEDFNESLLHRTTEIESFLRSDRDDKFIVIGTKGFGKT
Ga0075017_1004512352	3300006059	Watersheds	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTL
Ga0070715_108346071	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVADDFDDSLLHRTPEIDGFLTPSRDDKFIVIATKGF
Ga0070716_1013178611	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKTLL
Ga0097621_1019643002	3300006237	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPG
Ga0068871_1019356562	3300006358	Miscanthus Rhizosphere	MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIGTK
Ga0075421_1006599001	3300006845	Populus Rhizosphere	MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIG
Ga0075421_1009300431	3300006845	Populus Rhizosphere	MCHAPRNAAMRAWTVDADDIRVAEDFDEALLHRTPEIDGFLSLDRDDKFIVIGTKGFGKT
Ga0075430_1013524901	3300006846	Populus Rhizosphere	MRAWTVDADDIRVAEDLDEALLHRTPEIDSFLSLDRDDKFIVIGTKGFGKTL
Ga0075424_1006677161	3300006904	Populus Rhizosphere	MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIA
Ga0075419_101745223	3300006969	Populus Rhizosphere	MRAWTVDADDIRVAEDFDDALLHRTPEIDNFLTFDRD
Ga0066710_1024463472	3300009012	Grasslands Soil	VDADDIRVAEDFDETLLHRTPEIDSFLNLERDDKFIVIGTKGFGRRCC
Ga0105099_103605261	3300009082	Freshwater Sediment	MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDREDKF
Ga0099827_103462251	3300009090	Vadose Zone Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPD
Ga0111539_102186892	3300009094	Populus Rhizosphere	MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSD
Ga0079224_1019481811	3300009095	Agricultural Soil	MRAWTVDADDIRVAEDFDAALLHRTPEIEEFLSLGGDKFVV
Ga0075418_119380211	3300009100	Populus Rhizosphere	MRAWTVDADDIRVAEDFDEALLHHTPEIDSFLNLERDDKF
Ga0105247_109637752	3300009101	Switchgrass Rhizosphere	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGT
Ga0099792_109152801	3300009143	Vadose Zone Soil	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDR
Ga0105243_103438671	3300009148	Miscanthus Rhizosphere	MRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTLL
Ga0105243_109990582	3300009148	Miscanthus Rhizosphere	MRAWTVDADDIHVAEDFDASLPHRTPEIDTFLSPDRDDKFIV
Ga0105243_127566541	3300009148	Miscanthus Rhizosphere	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRD
Ga0111538_104132941	3300009156	Populus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKT
Ga0105092_107218182	3300009157	Freshwater Sediment	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDQFIVIGTK
Ga0075423_105859561	3300009162	Populus Rhizosphere	MRAWTVDADDIRVAEDFDDALLHRTPEIDNFLTFDRDDKFIVI
Ga0105101_106593972	3300009171	Freshwater Sediment	MRAWTVDADDIRVAEDFDDALLHRTPEIDAFLTPD
Ga0105242_107638762	3300009176	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGK
Ga0105248_101750794	3300009177	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLLHK
Ga0105248_101932741	3300009177	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKG
Ga0105248_112134661	3300009177	Switchgrass Rhizosphere	MLVAIECPEEVAMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLL
Ga0105066_10858872	3300009822	Groundwater Sand	MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL
Ga0131092_109491631	3300009870	Activated Sludge	MRAWTVDADDIRVAEDFDAAVLHRTPEIEEFLSPGG
Ga0105074_10736481	3300010029	Groundwater Sand	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTK
Ga0126384_121051622	3300010046	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDHDDKF
Ga0126384_121956612	3300010046	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDTFLSLD
Ga0126382_102651382	3300010047	Tropical Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDDFLTRDRD
Ga0126370_106170943	3300010358	Tropical Forest Soil	MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGT
Ga0126370_113521162	3300010358	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKGFGKT
Ga0126370_114055752	3300010358	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDR
Ga0126376_101030911	3300010359	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLLK
Ga0126376_109225771	3300010359	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDALLHRTPEIDGFLSPDRDDKFIV
Ga0126372_114755421	3300010360	Tropical Forest Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTLL
Ga0126372_116051731	3300010360	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKT
Ga0126372_131026031	3300010360	Tropical Forest Soil	MRAWTVDADDIRVAEDFSDSLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTLL
Ga0126378_129540312	3300010361	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPD
Ga0126377_100680763	3300010362	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIA
Ga0126379_106419032	3300010366	Tropical Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIA
Ga0126379_118772232	3300010366	Tropical Forest Soil	MRAWTVDADDVRVAEDFDDALLHRTPEIDTFLNLDRDDKFIVIGTKGFGK
Ga0126379_120448522	3300010366	Tropical Forest Soil	MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIATKGFGK
Ga0126379_122237962	3300010366	Tropical Forest Soil	MRAWTVDADDIRVAADLDDALLHRTPEIDSFLSLKRDDKFIVIGTKGF
Ga0134128_118239962	3300010373	Terrestrial Soil	MHAWTVDADDIRVADDFNDSLLHRTPEIDGFLRSDREDKFVIIGTKGFGKT
Ga0134124_102558342	3300010397	Terrestrial Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRQDRD
Ga0126383_118402611	3300010398	Tropical Forest Soil	MRAWTVDADDIRVAEDFDESLLHHTPEIDSFLNSDRDDKFIVIGTKGFGKTL
Ga0126383_120552011	3300010398	Tropical Forest Soil	MRAWTVDADDIRVAGDFDESLLHRTPEIETFLNPDRDDKFIVIGTK
Ga0134127_121888122	3300010399	Terrestrial Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLAPDRDDKFIVIATK
Ga0134122_115473681	3300010400	Terrestrial Soil	MRSWTVDADDIKIAEDFDDALLHKPPWLEAFLSAGGDEKFIVIGTKGFGKTLLLKA
Ga0134121_112624922	3300010401	Terrestrial Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTKGFGK
Ga0118733_1087671082	3300010430	Marine Sediment	MRPWTIDADDIRIADDFDDQLLHRTPWIEDFLDPRDDKFIVVATKGFGKTLL
Ga0105246_123481141	3300011119	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIIIGTK
Ga0137391_110105361	3300011270	Vadose Zone Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDK
Ga0137382_102381842	3300012200	Vadose Zone Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVIGTKDSARRCC*
Ga0137363_105137871	3300012202	Vadose Zone Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKT
Ga0137386_104730122	3300012351	Vadose Zone Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGK
Ga0137367_101701343	3300012353	Vadose Zone Soil	MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDD
Ga0137369_100798101	3300012355	Vadose Zone Soil	MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFIVIGTKGFGKTL
Ga0137384_101492743	3300012357	Vadose Zone Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGK
Ga0137375_102670293	3300012360	Vadose Zone Soil	VDADDIRVADDFDESLLHRTPEIESFLTPDRDDKFIVIATKGFGKTLLLKAIAHGIT
Ga0137361_107108563	3300012362	Vadose Zone Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIGTKGFGKT
Ga0157321_10183052	3300012487	Arabidopsis Rhizosphere	MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDR
Ga0137358_103685693	3300012582	Vadose Zone Soil	MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTK
Ga0137358_105826802	3300012582	Vadose Zone Soil	MRAWTLDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATK
Ga0157292_103210111	3300012900	Soil	MLVASSAGGERMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKT
Ga0137394_102235231	3300012922	Vadose Zone Soil	MRAWTVDADDIRVAEDLDDALLHHTPEIDSFLNLD
Ga0137394_110660691	3300012922	Vadose Zone Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKF
Ga0137359_105027441	3300012923	Vadose Zone Soil	MRAWTVDADDIRVAEDFNESLLHRTPEIDGFLSSDRDDKFIVIGTKGFGKTLLLK
Ga0137404_109332972	3300012929	Vadose Zone Soil	MRAWTVDADDIRVAEDFDESLLHRTAEIDNFLAPDRDDKFIIIGTKG
Ga0126375_105521812	3300012948	Tropical Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVI
Ga0126375_113864871	3300012948	Tropical Forest Soil	MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLL
Ga0126369_120949022	3300012971	Tropical Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRD
Ga0126369_122229501	3300012971	Tropical Forest Soil	MRAWTVDADDIRVAGDFNESLLHRTPEIDSFLRSDRDDKFIVIGTKD
Ga0126369_122435832	3300012971	Tropical Forest Soil	MRAWTVDADDIRVADDFDDTLLHRTPEIDGFLSSDRDDKFIVIGT
Ga0126369_133984661	3300012971	Tropical Forest Soil	MRAWTVDADDIRVADDFNESLLHRTPEIEAFLRSDRDDKFIVIGTKGFGKTLL
Ga0164305_105490741	3300012989	Soil	MRAWTVDAYYIRVAEDFNESLLHRTPEIDAFLRSDRDDKF
Ga0157371_101396461	3300013102	Corn Rhizosphere	MHAWTVDADDIRVADDFNDSLLHRTPEIDGFLRSDREDKFVIIGTK
Ga0157369_108881482	3300013105	Corn Rhizosphere	MRAWTVDADDIRVADDFDESLLHRTPEIDDFLRSDRDDKFIVIGTKGF
Ga0157378_117158231	3300013297	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLSPGRDDKFIVIGTKGFGKT
Ga0157372_100247696	3300013307	Corn Rhizosphere	MRAWTVGADAIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTKGFGKTLLL
Ga0157372_101929261	3300013307	Corn Rhizosphere	MRAWTVDADDIRVADDFDESLLHRTPEIDAFLNSSRDDKFVVIGTKGFGKTL
Ga0157372_112910762	3300013307	Corn Rhizosphere	MRAWTVDADDIRVAEDFNESLLHRTPEIDAFLRSDRDDKFIVIGT
Ga0163163_114573832	3300014325	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPDRDD
Ga0163163_115092481	3300014325	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDK
Ga0157380_106007752	3300014326	Switchgrass Rhizosphere	MLVAIQCPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGF
Ga0157380_135496791	3300014326	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLGLDRDDKFIVIGTKGFGKTLL
Ga0182021_112389413	3300014502	Fen	MRPWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDD
Ga0157379_106113821	3300014968	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTL
Ga0157379_117842951	3300014968	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPARDDKFIVIATK
Ga0137418_103045703	3300015241	Vadose Zone Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIV
Ga0132258_105172541	3300015371	Arabidopsis Rhizosphere	MRAWTVDADDIRVADDFDDSLLHRTPEIDGFLTPSRDDKFIVIATK
Ga0132258_106630626	3300015371	Arabidopsis Rhizosphere	MRAWTVDADDIRVAEDFNESLLHRTPEIDGFLSSDRDDKFIVIGTKGFG
Ga0132258_131479923	3300015371	Arabidopsis Rhizosphere	MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGK
Ga0132256_1012931992	3300015372	Arabidopsis Rhizosphere	MRAWTVDADDIQVAEDLSARDLHQTPGIEAFLAPQRGDKFIVVATKGFGKTLLLKA
Ga0132256_1019344631	3300015372	Arabidopsis Rhizosphere	MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIATKGFGKT
Ga0132257_1013657161	3300015373	Arabidopsis Rhizosphere	MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIV
Ga0132257_1018401552	3300015373	Arabidopsis Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPD
Ga0132257_1026439762	3300015373	Arabidopsis Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGFGK
Ga0132257_1042514931	3300015373	Arabidopsis Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDKFIV
Ga0132255_1024869262	3300015374	Arabidopsis Rhizosphere	MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKFIVIGT
Ga0132255_1060151131	3300015374	Arabidopsis Rhizosphere	MRAWTVDADDIRVADDFDESLLHRTPEIDGFLSSDRDDKFVVIGTKGFGKT
Ga0182035_106841701	3300016341	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIV
Ga0182035_109079992	3300016341	Soil	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLGSDRDDKFIVIGTKGFGK
Ga0182034_107403091	3300016371	Soil	MRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDRDDKF
Ga0182039_102965853	3300016422	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKF
Ga0163161_100216111	3300017792	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTK
Ga0190266_102885741	3300017965	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTL
Ga0190266_113421531	3300017965	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKF
Ga0184604_103455851	3300018000	Groundwater Sediment	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIGTKG
Ga0187766_108917352	3300018058	Tropical Peatland	MRAWTVDADDIRVVEDFDESLLCRTPEIDSFLTPD
Ga0187765_105164122	3300018060	Tropical Peatland	MRAWTVDADDIRVAEDFDESLLHHTPEIDGFLRSDRDD
Ga0184618_100436312	3300018071	Groundwater Sediment	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVI
Ga0184629_100339893	3300018084	Groundwater Sediment	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDD
Ga0184629_106928482	3300018084	Groundwater Sediment	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDD
Ga0193723_11055642	3300019879	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVI
Ga0206353_118416511	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFI
Ga0163149_104722332	3300020596	Freshwater Microbial Mat	MRAWTVDADDIRVAEDFDAGLLHRTPEIDDFLSPGGEKFVVIGTK
Ga0210380_102655332	3300021082	Groundwater Sediment	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIG
Ga0210404_106942852	3300021088	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFI
Ga0210406_112133192	3300021168	Soil	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKCIVIGTKGFGKTLLLK
Ga0210400_100217306	3300021170	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIV
Ga0210397_111978691	3300021403	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGF
Ga0182009_101683552	3300021445	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLL
Ga0210390_106740751	3300021474	Soil	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGK
Ga0126371_105902513	3300021560	Tropical Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATK
Ga0126371_129204582	3300021560	Tropical Forest Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTK
Ga0222623_102260292	3300022694	Groundwater Sediment	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLGVDRDDKFIV
Ga0247796_10474121	3300023261	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFV
Ga0124853_11601091	3300024056	Freshwater Wetlands	MRAWTVDADDIRVAADFNEALLHRTPEIEGFLRADRDDKFIIIGTKGF
Ga0207656_106335402	3300025321	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGF
Ga0207645_110868181	3300025907	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDNFLTPGHDDKFVVIGT
Ga0207707_107244701	3300025912	Corn Rhizosphere	MHAWTVDADDIRVADDFNDSLLHRTPEIDAFLRSDRDDKFVIIGTKGFGKTL
Ga0207663_109984522	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFSESLLHRTPEIEGFLRSDRDDKFIVIGTKGFG
Ga0207663_110380882	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTLLL
Ga0207660_117241562	3300025917	Corn Rhizosphere	MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTL
Ga0207649_108287311	3300025920	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLLL
Ga0207649_114724732	3300025920	Corn Rhizosphere	MRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKG
Ga0207681_106201852	3300025923	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRD
Ga0207694_101205323	3300025924	Corn Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPDRDDKFIVI
Ga0207701_114346942	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MRAWTVDADDIRVADDFDDSLLHRTPEIDAFLTESRDDKFIVIATKGFGKTLLL
Ga0207644_107792692	3300025931	Switchgrass Rhizosphere	MRAWTVDADDIRVADDFDDSLLHRTPEIDAFLTESR
Ga0207706_103450232	3300025933	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFG
Ga0207709_105008412	3300025935	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDD
Ga0207704_108014762	3300025938	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKG
Ga0207711_101221654	3300025941	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDK
Ga0207711_103876042	3300025941	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPD
Ga0207711_117697471	3300025941	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDD
Ga0207679_113641572	3300025945	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLAPGRDDKFIVIGTKGFGKTLLL
Ga0207640_113709401	3300025981	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDTFVVI
Ga0207658_100181721	3300025986	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKGFGKTLL
Ga0207658_103711892	3300025986	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTK
Ga0207677_100328841	3300026023	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVI
Ga0207677_122325541	3300026023	Miscanthus Rhizosphere	MRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDKFIVIGTKGF
Ga0207641_101519673	3300026088	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRD
Ga0207641_108649082	3300026088	Switchgrass Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIA
Ga0207641_122604172	3300026088	Switchgrass Rhizosphere	VASGSLEECMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIAT
Ga0207674_110526732	3300026116	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGF
Ga0207683_101416711	3300026121	Miscanthus Rhizosphere	MLVAIQCPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGK
Ga0207683_109001991	3300026121	Miscanthus Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLSLD
Ga0207698_103789741	3300026142	Corn Rhizosphere	MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKF
Ga0207698_113499671	3300026142	Corn Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGF
Ga0209057_12326471	3300026342	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLLKA
Ga0257180_10058572	3300026354	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFI
Ga0257152_10293861	3300026369	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRD
Ga0257160_10359762	3300026489	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKG
Ga0209056_100835863	3300026538	Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDD
Ga0209897_10060774	3300027169	Groundwater Sand	MRAWTVDADDIRVAEDFDDALLHRTPEIDGFLTLDRDDKFIVIGTKGFGKTLL
Ga0209854_10221462	3300027384	Groundwater Sand	MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFI
Ga0209874_10116225	3300027577	Groundwater Sand	MRAWTVDADDIRVAEDFDDALLHRTPEIDNFLNLDRDDKF
Ga0209799_11393321	3300027654	Tropical Forest Soil	MRAWTVDADDIRVAADFDDALLHRTPEIDSFLSLERDDKFIVIGTKGFGKTLLLKA
Ga0209328_101601921	3300027727	Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPG
Ga0209177_101576951	3300027775	Agricultural Soil	MRAWTVDADDIRVAADFDEALLHRTPEIDSFLSVER
Ga0209180_106155851	3300027846	Vadose Zone Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVI
Ga0209668_101183302	3300027899	Freshwater Lake Sediment	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFI
Ga0209382_105403462	3300027909	Populus Rhizosphere	MRAWTVDADDIHVAEDFDASLLHRTPEIDAFLSPDRDDKFIVIG
Ga0209583_1000005637	3300027910	Watersheds	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLAPERDDKFIVTGTKGFGKTLL
(restricted) Ga0233417_106392132	3300028043	Sediment	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLNPDRDDQFVVIGTKGFG
Ga0307283_101911771	3300028790	Soil	MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDD
Ga0302254_101085141	3300028870	Fen	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVIGTKGFGKTLLL
Ga0307278_103593431	3300028878	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTL
Ga0311329_106113373	3300029907	Bog	MRAWTVDADDIQVAEDFDESLLHRTPEIDGFLRSDRDGKFIVIGTKGFGKTLLLK
Ga0311334_118436951	3300029987	Fen	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGT
Ga0311365_118529321	3300029989	Fen	MRAWTVDADDIRVAEDFDETLLHRTPEIDSFLAPDRDDKFIVIGT
Ga0311336_102499611	3300029990	Fen	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIV
Ga0311348_102892542	3300030019	Fen	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIV
Ga0311360_108434522	3300030339	Bog	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIG
Ga0311335_106662652	3300030838	Fen	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGF
Ga0170824_1172682381	3300031231	Forest Soil	MRAWTVDADDIRVAEDFDDSLLHRTPEIDAFLTPGRD
Ga0302323_1004190683	3300031232	Fen	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRD
Ga0302323_1030493711	3300031232	Fen	MRAWTVDADDIRVAEDFDETLLHRTPEIDSFLAPDR
Ga0310886_103846871	3300031562	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPDR
Ga0318555_102159033	3300031640	Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGFGKT
Ga0318555_103992471	3300031640	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLD
Ga0310813_120012171	3300031716	Soil	MRPWTIDADDIQVAEDFDASLLHRTNWIDDFLAHGRDERFIVTGTKGFGKTL
Ga0307469_117913702	3300031720	Hardwood Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRPDRDDKFIV
Ga0302321_1028476922	3300031726	Fen	MRAWTVDADDIRVADDLDEALLHRTPEIEAFLSPE
Ga0307516_103677902	3300031730	Ectomycorrhiza	MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDREDKFIV
Ga0307405_102605133	3300031731	Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDD
Ga0307468_1006901391	3300031740	Hardwood Forest Soil	MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTKG
Ga0307468_1009099482	3300031740	Hardwood Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDK
Ga0307468_1010292271	3300031740	Hardwood Forest Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDDFLTRDRDDKFIVIGTKGFGKTL
Ga0307468_1016126442	3300031740	Hardwood Forest Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDAFLAPS
Ga0318521_104542702	3300031770	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKG
Ga0318529_104553222	3300031792	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRNDKFI
Ga0318568_105231442	3300031819	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKGF
Ga0307473_100557482	3300031820	Hardwood Forest Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIG
Ga0307473_101334901	3300031820	Hardwood Forest Soil	MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLD
Ga0307473_110339781	3300031820	Hardwood Forest Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLNLERDD
Ga0307413_112819902	3300031824	Rhizosphere	MRAWTVDADDIRVAEDFDDALLHRTPEIEGFLTPGS
Ga0318520_105124341	3300031897	Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDAFLTPGRDDKF
Ga0307407_114101951	3300031903	Rhizosphere	MRAWTVDADDIRIAEDFDESLLHRTPEIDAFLRSDRDEKFI
Ga0306921_112946652	3300031912	Soil	MRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDR
Ga0310912_108935701	3300031941	Soil	MRAWTVDADDIQVAEDFNESLLHRTPEIDGFLRSDRDDKFIV
Ga0310885_109184781	3300031943	Soil	MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIG
Ga0307409_1009997661	3300031995	Rhizosphere	MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLNLERDDKFIVIG
Ga0308176_125516822	3300031996	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIVAFLTPDRDDKFI
Ga0307416_1003222673	3300032002	Rhizosphere	MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDRDDKFIVIGTKGFGKTLL
Ga0307414_111426202	3300032004	Rhizosphere	MRAWTVDADDIRIAEDFDESLLHRTPEIDAFLRSDRDEKFIVIGTK
Ga0307411_106146491	3300032005	Rhizosphere	MRAWTVDADDIHVADDFDESLLHRTPEIDGFLRLDRDD
Ga0318562_104392242	3300032008	Soil	MRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDRDDKFIVIG
Ga0318563_102799471	3300032009	Soil	MRAWTVDADDIQVAEDFNESLLHRTAEIEGFLHSDRDD
Ga0318507_104427512	3300032025	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFI
Ga0318510_105076571	3300032064	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKG
Ga0318553_105424892	3300032068	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIVIGTK
Ga0308173_113345142	3300032074	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVV
Ga0308173_116007132	3300032074	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLLL
Ga0315292_117130952	3300032143	Sediment	MRAWTVDADDIRVAEDFNESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKT
Ga0315910_116149942	3300032144	Soil	MRAWTVDADDIRVTEDFDDSLLHRTPEIEAFLRSDRDDKFIVIGTKGFGKTLLL
Ga0307471_1004536623	3300032180	Hardwood Forest Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDD
Ga0307472_1025335401	3300032205	Hardwood Forest Soil	MRAWTVDADDIRVAEDFDDALLHETPEITSFLNLDG
Ga0315271_108214651	3300032256	Sediment	MRAWTVDADDIRVADDFDESLLHRTPEIDGFLSPGRDDKFIVIGTKGF
Ga0306920_1010755221	3300032261	Soil	MRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTL
Ga0335082_102841602	3300032782	Soil	MKAWTVDADDIRVTEDFDESLLHRTPEIDDFLSQDRDDKFV
Ga0335082_104466532	3300032782	Soil	MRAWTVDADDIRVAEDFNESLLHRTPEIEGFLRSDRD
Ga0335082_111257551	3300032782	Soil	MRAWTVDADDIRVAEDFDDTLLHRTPEIDAFLSPERDDKFVVIGTKGF
Ga0335070_103440071	3300032829	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPNRDDKFIVIGTK
Ga0335069_120988211	3300032893	Soil	MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKTL
Ga0310914_103068123	3300033289	Soil	MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRD
Ga0316604_102382962	3300033406	Soil	MRAWTVDADDIRVAEDFDEALLHRTVEIDAFLTPGRDDKFIVIGTKGF
Ga0214472_114784921	3300033407	Soil	MRAWTVDADDIRVAEDFDAALLHRTPEIDEFLSHGGEKFVVVGTK
Ga0316625_1003080052	3300033418	Soil	MRAWTVDADDIRVAEDFDDTLLHRTPEIDAFLTPDRDDKFIVIGTK
Ga0316625_1014370992	3300033418	Soil	MRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKT
Ga0316613_100537361	3300033434	Soil	MRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDQF
Ga0316600_100508041	3300033481	Soil	MRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKTL
Ga0316627_1014666782	3300033482	Soil	MRAWTVDADDIRVAEDFDETLLHRTAEIDVFLTPGRDDKFIVI
Ga0316627_1016387552	3300033482	Soil	MRAWTVDADDIRVAEDFDETLLHRTPEIEAFLAPDREDKFIVIGTKGFGKTL
Ga0316621_112120901	3300033488	Soil	MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLSPDREDKFIV
Ga0247830_117338631	3300033551	Soil	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGK
Ga0364925_0404328_2_115	3300034147	Sediment	MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDD
Ga0370510_0126372_621_779	3300034160	Untreated Peat Soil	MRAWTVDADDIRVADDFDDSLLHRTPEIDAFLSPDRDDKFIVVGTKGFGKTLL