Basic Information | |
---|---|
Family ID | F009639 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 315 |
Average Sequence Length | 45 residues |
Representative Sequence | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGT |
Number of Associated Samples | 237 |
Number of Associated Scaffolds | 315 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 92.38 % |
% of genes near scaffold ends (potentially truncated) | 99.68 % |
% of genes from short scaffolds (< 2000 bps) | 90.48 % |
Associated GOLD sequencing projects | 226 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.206 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.571 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.190 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.270 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 315 Family Scaffolds |
---|---|---|
PF00296 | Bac_luciferase | 6.98 |
PF02446 | Glyco_hydro_77 | 3.17 |
PF00441 | Acyl-CoA_dh_1 | 2.22 |
PF01740 | STAS | 1.90 |
PF13458 | Peripla_BP_6 | 1.90 |
PF04392 | ABC_sub_bind | 1.59 |
PF02518 | HATPase_c | 1.27 |
PF02515 | CoA_transf_3 | 1.27 |
PF01566 | Nramp | 1.27 |
PF14031 | D-ser_dehydrat | 1.27 |
PF03372 | Exo_endo_phos | 0.95 |
PF01591 | 6PF2K | 0.95 |
PF08020 | DUF1706 | 0.95 |
PF08000 | bPH_1 | 0.95 |
PF05088 | Bac_GDH | 0.95 |
PF01738 | DLH | 0.95 |
PF00072 | Response_reg | 0.95 |
PF13336 | AcetylCoA_hyd_C | 0.95 |
PF01557 | FAA_hydrolase | 0.95 |
PF13378 | MR_MLE_C | 0.95 |
PF02872 | 5_nucleotid_C | 0.95 |
PF02627 | CMD | 0.95 |
PF02826 | 2-Hacid_dh_C | 0.63 |
PF13365 | Trypsin_2 | 0.63 |
PF03466 | LysR_substrate | 0.63 |
PF00266 | Aminotran_5 | 0.63 |
PF13379 | NMT1_2 | 0.63 |
PF15902 | Sortilin-Vps10 | 0.63 |
PF13343 | SBP_bac_6 | 0.63 |
PF04986 | Y2_Tnp | 0.63 |
PF00300 | His_Phos_1 | 0.63 |
PF02770 | Acyl-CoA_dh_M | 0.63 |
PF00561 | Abhydrolase_1 | 0.63 |
PF00043 | GST_C | 0.63 |
PF01764 | Lipase_3 | 0.63 |
PF00005 | ABC_tran | 0.63 |
PF06808 | DctM | 0.63 |
PF13561 | adh_short_C2 | 0.63 |
PF13442 | Cytochrome_CBB3 | 0.32 |
PF12697 | Abhydrolase_6 | 0.32 |
PF07690 | MFS_1 | 0.32 |
PF07883 | Cupin_2 | 0.32 |
PF12850 | Metallophos_2 | 0.32 |
PF12276 | DUF3617 | 0.32 |
PF13181 | TPR_8 | 0.32 |
PF02811 | PHP | 0.32 |
PF12439 | GDE_N | 0.32 |
PF16868 | NMT1_3 | 0.32 |
PF00486 | Trans_reg_C | 0.32 |
PF00903 | Glyoxalase | 0.32 |
PF01804 | Penicil_amidase | 0.32 |
PF02805 | Ada_Zn_binding | 0.32 |
PF12225 | DUF5981 | 0.32 |
PF12973 | Cupin_7 | 0.32 |
PF13185 | GAF_2 | 0.32 |
PF00106 | adh_short | 0.32 |
PF02604 | PhdYeFM_antitox | 0.32 |
PF00496 | SBP_bac_5 | 0.32 |
PF04228 | Zn_peptidase | 0.32 |
PF02538 | Hydantoinase_B | 0.32 |
PF09084 | NMT1 | 0.32 |
PF01323 | DSBA | 0.32 |
PF00701 | DHDPS | 0.32 |
PF07730 | HisKA_3 | 0.32 |
PF04186 | FxsA | 0.32 |
PF13538 | UvrD_C_2 | 0.32 |
PF10518 | TAT_signal | 0.32 |
PF07366 | SnoaL | 0.32 |
PF02574 | S-methyl_trans | 0.32 |
PF14520 | HHH_5 | 0.32 |
PF00582 | Usp | 0.32 |
PF00873 | ACR_tran | 0.32 |
PF03795 | YCII | 0.32 |
PF01569 | PAP2 | 0.32 |
PF01636 | APH | 0.32 |
PF01717 | Meth_synt_2 | 0.32 |
PF00211 | Guanylate_cyc | 0.32 |
PF00067 | p450 | 0.32 |
PF00939 | Na_sulph_symp | 0.32 |
PF01833 | TIG | 0.32 |
PF09723 | Zn-ribbon_8 | 0.32 |
PF07719 | TPR_2 | 0.32 |
PF01553 | Acyltransferase | 0.32 |
PF00881 | Nitroreductase | 0.32 |
PF08241 | Methyltransf_11 | 0.32 |
PF13366 | PDDEXK_3 | 0.32 |
PF04366 | Ysc84 | 0.32 |
PF04143 | Sulf_transp | 0.32 |
PF12399 | BCA_ABC_TP_C | 0.32 |
PF00114 | Pilin | 0.32 |
PF01817 | CM_2 | 0.32 |
PF11745 | DUF3304 | 0.32 |
PF07973 | tRNA_SAD | 0.32 |
PF10137 | TIR-like | 0.32 |
PF04828 | GFA | 0.32 |
PF00692 | dUTPase | 0.32 |
PF13683 | rve_3 | 0.32 |
PF00487 | FA_desaturase | 0.32 |
COG ID | Name | Functional Category | % Frequency in 315 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.98 |
COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 3.17 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.86 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.59 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.27 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.27 |
COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.95 |
COG0737 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family | Defense mechanisms [V] | 0.95 |
COG4283 | Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domain | General function prediction only [R] | 0.95 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.95 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 0.63 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.63 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.32 |
COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.32 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.32 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.32 |
COG3030 | FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family | General function prediction only [R] | 0.32 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.32 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.32 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.32 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.32 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.32 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.32 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.32 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.32 |
COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.32 |
COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 0.32 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.32 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.32 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.32 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.32 |
COG1605 | Chorismate mutase | Amino acid transport and metabolism [E] | 0.32 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.32 |
COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.32 |
COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.32 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.32 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.32 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.32 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.32 |
COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.79 % |
Unclassified | root | N/A | 9.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_140510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1381 | Open in IMG/M |
2199352024|deeps_contig94323.55736 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0478262 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100394304 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 861 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101823195 | All Organisms → cellular organisms → Bacteria | 3511 | Open in IMG/M |
3300001431|F14TB_100706542 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300001431|F14TB_100898091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1294 | Open in IMG/M |
3300001431|F14TB_102522881 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300003669|LSCM4E_1019157 | Not Available | 1189 | Open in IMG/M |
3300004156|Ga0062589_102206761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
3300004267|Ga0066396_10098101 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300004463|Ga0063356_100071675 | All Organisms → cellular organisms → Bacteria | 3609 | Open in IMG/M |
3300004633|Ga0066395_10294459 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 885 | Open in IMG/M |
3300004633|Ga0066395_10357653 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300004633|Ga0066395_10733233 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300005093|Ga0062594_101315876 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 726 | Open in IMG/M |
3300005171|Ga0066677_10205061 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300005171|Ga0066677_10319745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
3300005178|Ga0066688_10427482 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300005289|Ga0065704_10313500 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 864 | Open in IMG/M |
3300005294|Ga0065705_11091982 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
3300005331|Ga0070670_100384188 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300005332|Ga0066388_102019163 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300005332|Ga0066388_104282091 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300005334|Ga0068869_100986296 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 733 | Open in IMG/M |
3300005343|Ga0070687_100222623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1157 | Open in IMG/M |
3300005353|Ga0070669_100177247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1665 | Open in IMG/M |
3300005355|Ga0070671_100854233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 794 | Open in IMG/M |
3300005364|Ga0070673_102060177 | Not Available | 542 | Open in IMG/M |
3300005434|Ga0070709_11731331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8 | 511 | Open in IMG/M |
3300005436|Ga0070713_100455512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8 | 1202 | Open in IMG/M |
3300005439|Ga0070711_100319593 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300005440|Ga0070705_101123774 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300005441|Ga0070700_100842811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 742 | Open in IMG/M |
3300005468|Ga0070707_100524900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium | 1146 | Open in IMG/M |
3300005468|Ga0070707_101009456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300005546|Ga0070696_100343070 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300005563|Ga0068855_100864075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8 | 958 | Open in IMG/M |
3300005587|Ga0066654_10558791 | Not Available | 631 | Open in IMG/M |
3300005616|Ga0068852_101890049 | Not Available | 619 | Open in IMG/M |
3300005713|Ga0066905_100913939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 769 | Open in IMG/M |
3300005719|Ga0068861_100173862 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300005719|Ga0068861_100961686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 813 | Open in IMG/M |
3300005719|Ga0068861_101189788 | Not Available | 737 | Open in IMG/M |
3300005764|Ga0066903_100276409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2627 | Open in IMG/M |
3300005764|Ga0066903_100735462 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300005764|Ga0066903_101651180 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300005764|Ga0066903_102513459 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300005764|Ga0066903_102782820 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300005764|Ga0066903_106005403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
3300005764|Ga0066903_107024338 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
3300005764|Ga0066903_108560963 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888 | 521 | Open in IMG/M |
3300005836|Ga0074470_11618877 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300005841|Ga0068863_101005180 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300005843|Ga0068860_100968762 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300005843|Ga0068860_101552128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 684 | Open in IMG/M |
3300005983|Ga0081540_1022607 | All Organisms → cellular organisms → Bacteria | 3710 | Open in IMG/M |
3300006049|Ga0075417_10022318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni | 2537 | Open in IMG/M |
3300006050|Ga0075028_100163299 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300006059|Ga0075017_100451235 | Not Available | 971 | Open in IMG/M |
3300006163|Ga0070715_10834607 | Not Available | 562 | Open in IMG/M |
3300006173|Ga0070716_101317861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 584 | Open in IMG/M |
3300006237|Ga0097621_101964300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 559 | Open in IMG/M |
3300006358|Ga0068871_101935656 | Not Available | 561 | Open in IMG/M |
3300006845|Ga0075421_100659900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1221 | Open in IMG/M |
3300006845|Ga0075421_100930043 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300006846|Ga0075430_101352490 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300006904|Ga0075424_100667716 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300006969|Ga0075419_10174522 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300009012|Ga0066710_102446347 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300009082|Ga0105099_10360526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 861 | Open in IMG/M |
3300009090|Ga0099827_10346225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium | 1264 | Open in IMG/M |
3300009094|Ga0111539_10218689 | Not Available | 2219 | Open in IMG/M |
3300009095|Ga0079224_101948181 | Not Available | 834 | Open in IMG/M |
3300009100|Ga0075418_11938021 | Not Available | 641 | Open in IMG/M |
3300009101|Ga0105247_10963775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
3300009143|Ga0099792_10915280 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300009148|Ga0105243_10343867 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300009148|Ga0105243_10999058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
3300009148|Ga0105243_12756654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
3300009156|Ga0111538_10413294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 1709 | Open in IMG/M |
3300009157|Ga0105092_10721818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
3300009162|Ga0075423_10585956 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300009171|Ga0105101_10659397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 521 | Open in IMG/M |
3300009176|Ga0105242_10763876 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300009177|Ga0105248_10175079 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300009177|Ga0105248_10193274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2293 | Open in IMG/M |
3300009177|Ga0105248_11213466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 853 | Open in IMG/M |
3300009822|Ga0105066_1085887 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300009870|Ga0131092_10949163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
3300010029|Ga0105074_1073648 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300010046|Ga0126384_12105162 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010046|Ga0126384_12195661 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300010047|Ga0126382_10265138 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300010358|Ga0126370_10617094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 939 | Open in IMG/M |
3300010358|Ga0126370_11352116 | Not Available | 670 | Open in IMG/M |
3300010358|Ga0126370_11405575 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
3300010359|Ga0126376_10103091 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
3300010359|Ga0126376_10922577 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300010360|Ga0126372_11475542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 715 | Open in IMG/M |
3300010360|Ga0126372_11605173 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300010360|Ga0126372_13102603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
3300010361|Ga0126378_12954031 | Not Available | 542 | Open in IMG/M |
3300010362|Ga0126377_10068076 | All Organisms → cellular organisms → Bacteria | 3159 | Open in IMG/M |
3300010366|Ga0126379_10641903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1151 | Open in IMG/M |
3300010366|Ga0126379_11877223 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300010366|Ga0126379_12044852 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
3300010366|Ga0126379_12223796 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
3300010373|Ga0134128_11823996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus | 669 | Open in IMG/M |
3300010397|Ga0134124_10255834 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
3300010398|Ga0126383_11840261 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300010398|Ga0126383_12055201 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300010399|Ga0134127_12188812 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300010400|Ga0134122_11547368 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300010401|Ga0134121_11262492 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300010430|Ga0118733_108767108 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300011119|Ga0105246_12348114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 522 | Open in IMG/M |
3300011270|Ga0137391_11010536 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300012200|Ga0137382_10238184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1259 | Open in IMG/M |
3300012202|Ga0137363_10513787 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1007 | Open in IMG/M |
3300012351|Ga0137386_10473012 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300012353|Ga0137367_10170134 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
3300012355|Ga0137369_10079810 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
3300012357|Ga0137384_10149274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1956 | Open in IMG/M |
3300012360|Ga0137375_10267029 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
3300012362|Ga0137361_10710856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 917 | Open in IMG/M |
3300012487|Ga0157321_1018305 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012582|Ga0137358_10368569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
3300012582|Ga0137358_10582680 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300012900|Ga0157292_10321011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300012922|Ga0137394_10223523 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300012922|Ga0137394_11066069 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300012923|Ga0137359_10502744 | Not Available | 1069 | Open in IMG/M |
3300012929|Ga0137404_10933297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40 | 792 | Open in IMG/M |
3300012948|Ga0126375_10552181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 870 | Open in IMG/M |
3300012948|Ga0126375_11386487 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012971|Ga0126369_12094902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
3300012971|Ga0126369_12222950 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300012971|Ga0126369_12243583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter | 633 | Open in IMG/M |
3300012971|Ga0126369_13398466 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300012989|Ga0164305_10549074 | Not Available | 919 | Open in IMG/M |
3300013102|Ga0157371_10139646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1726 | Open in IMG/M |
3300013105|Ga0157369_10888148 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 914 | Open in IMG/M |
3300013297|Ga0157378_11715823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 675 | Open in IMG/M |
3300013307|Ga0157372_10024769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus | 6521 | Open in IMG/M |
3300013307|Ga0157372_10192926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2359 | Open in IMG/M |
3300013307|Ga0157372_11291076 | Not Available | 842 | Open in IMG/M |
3300014325|Ga0163163_11457383 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300014325|Ga0163163_11509248 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300014326|Ga0157380_10600775 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300014326|Ga0157380_13549679 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300014502|Ga0182021_11238941 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300014968|Ga0157379_10611382 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300014968|Ga0157379_11784295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
3300015241|Ga0137418_10304570 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300015371|Ga0132258_10517254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2987 | Open in IMG/M |
3300015371|Ga0132258_10663062 | All Organisms → cellular organisms → Bacteria | 2624 | Open in IMG/M |
3300015371|Ga0132258_13147992 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300015372|Ga0132256_101293199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 842 | Open in IMG/M |
3300015372|Ga0132256_101934463 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300015373|Ga0132257_101365716 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300015373|Ga0132257_101840155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 778 | Open in IMG/M |
3300015373|Ga0132257_102643976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
3300015373|Ga0132257_104251493 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300015374|Ga0132255_102486926 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300015374|Ga0132255_106015113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
3300016341|Ga0182035_10684170 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300016341|Ga0182035_10907999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
3300016371|Ga0182034_10740309 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300016422|Ga0182039_10296585 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
3300017792|Ga0163161_10021611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4522 | Open in IMG/M |
3300017965|Ga0190266_10288574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 848 | Open in IMG/M |
3300017965|Ga0190266_11342153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 505 | Open in IMG/M |
3300018000|Ga0184604_10345585 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300018058|Ga0187766_10891735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
3300018060|Ga0187765_10516412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii | 758 | Open in IMG/M |
3300018071|Ga0184618_10043631 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300018084|Ga0184629_10033989 | Not Available | 2228 | Open in IMG/M |
3300018084|Ga0184629_10692848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp. | 513 | Open in IMG/M |
3300019879|Ga0193723_1105564 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300020082|Ga0206353_11841651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
3300020596|Ga0163149_10472233 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300021082|Ga0210380_10265533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 779 | Open in IMG/M |
3300021088|Ga0210404_10694285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
3300021168|Ga0210406_11213319 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300021170|Ga0210400_10021730 | All Organisms → cellular organisms → Bacteria | 5006 | Open in IMG/M |
3300021403|Ga0210397_11197869 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
3300021445|Ga0182009_10168355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 1051 | Open in IMG/M |
3300021474|Ga0210390_10674075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 863 | Open in IMG/M |
3300021560|Ga0126371_10590251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1260 | Open in IMG/M |
3300021560|Ga0126371_12920458 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300022694|Ga0222623_10226029 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300023261|Ga0247796_1047412 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300024056|Ga0124853_1160109 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300025321|Ga0207656_10633540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 546 | Open in IMG/M |
3300025907|Ga0207645_11086818 | Not Available | 540 | Open in IMG/M |
3300025912|Ga0207707_10724470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
3300025916|Ga0207663_10998452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
3300025916|Ga0207663_11038088 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300025917|Ga0207660_11724156 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300025920|Ga0207649_10828731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
3300025920|Ga0207649_11472473 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300025923|Ga0207681_10620185 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300025924|Ga0207694_10120532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2094 | Open in IMG/M |
3300025930|Ga0207701_11434694 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300025931|Ga0207644_10779269 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300025933|Ga0207706_10345023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1295 | Open in IMG/M |
3300025935|Ga0207709_10500841 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300025938|Ga0207704_10801476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 786 | Open in IMG/M |
3300025941|Ga0207711_10122165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2326 | Open in IMG/M |
3300025941|Ga0207711_10387604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1297 | Open in IMG/M |
3300025941|Ga0207711_11769747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
3300025945|Ga0207679_11364157 | Not Available | 651 | Open in IMG/M |
3300025981|Ga0207640_11370940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 633 | Open in IMG/M |
3300025986|Ga0207658_10018172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4851 | Open in IMG/M |
3300025986|Ga0207658_10371189 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300026023|Ga0207677_10032884 | All Organisms → cellular organisms → Bacteria | 3339 | Open in IMG/M |
3300026023|Ga0207677_12232554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8 | 509 | Open in IMG/M |
3300026088|Ga0207641_10151967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2097 | Open in IMG/M |
3300026088|Ga0207641_10864908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 897 | Open in IMG/M |
3300026088|Ga0207641_12260417 | Not Available | 544 | Open in IMG/M |
3300026116|Ga0207674_11052673 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 783 | Open in IMG/M |
3300026121|Ga0207683_10141671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2167 | Open in IMG/M |
3300026121|Ga0207683_10900199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
3300026142|Ga0207698_10378974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
3300026142|Ga0207698_11349967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 728 | Open in IMG/M |
3300026342|Ga0209057_1232647 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300026354|Ga0257180_1005857 | Not Available | 1352 | Open in IMG/M |
3300026369|Ga0257152_1029386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
3300026489|Ga0257160_1035976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 830 | Open in IMG/M |
3300026538|Ga0209056_10083586 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
3300027169|Ga0209897_1006077 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
3300027384|Ga0209854_1022146 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300027577|Ga0209874_1011622 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
3300027654|Ga0209799_1139332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
3300027727|Ga0209328_10160192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 683 | Open in IMG/M |
3300027775|Ga0209177_10157695 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300027846|Ga0209180_10615585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. | 599 | Open in IMG/M |
3300027899|Ga0209668_10118330 | Not Available | 1567 | Open in IMG/M |
3300027909|Ga0209382_10540346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1278 | Open in IMG/M |
3300027910|Ga0209583_10000056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 34920 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10639213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
3300028790|Ga0307283_10191177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
3300028870|Ga0302254_10108514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1015 | Open in IMG/M |
3300028878|Ga0307278_10359343 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300029907|Ga0311329_10611337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 721 | Open in IMG/M |
3300029987|Ga0311334_11843695 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300029989|Ga0311365_11852932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
3300029990|Ga0311336_10249961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1456 | Open in IMG/M |
3300030019|Ga0311348_10289254 | Not Available | 1222 | Open in IMG/M |
3300030339|Ga0311360_10843452 | Not Available | 727 | Open in IMG/M |
3300030838|Ga0311335_10666265 | Not Available | 731 | Open in IMG/M |
3300031231|Ga0170824_117268238 | Not Available | 711 | Open in IMG/M |
3300031232|Ga0302323_100419068 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300031232|Ga0302323_103049371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
3300031562|Ga0310886_10384687 | Not Available | 824 | Open in IMG/M |
3300031640|Ga0318555_10215903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1035 | Open in IMG/M |
3300031640|Ga0318555_10399247 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300031716|Ga0310813_12001217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 546 | Open in IMG/M |
3300031720|Ga0307469_11791370 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica | 593 | Open in IMG/M |
3300031726|Ga0302321_102847692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila | 565 | Open in IMG/M |
3300031730|Ga0307516_10367790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1101 | Open in IMG/M |
3300031731|Ga0307405_10260513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1295 | Open in IMG/M |
3300031740|Ga0307468_100690139 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300031740|Ga0307468_100909948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
3300031740|Ga0307468_101029227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
3300031740|Ga0307468_101612644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis | 607 | Open in IMG/M |
3300031770|Ga0318521_10454270 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300031792|Ga0318529_10455322 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300031819|Ga0318568_10523144 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300031820|Ga0307473_10055748 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
3300031820|Ga0307473_10133490 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300031820|Ga0307473_11033978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 602 | Open in IMG/M |
3300031824|Ga0307413_11281990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 640 | Open in IMG/M |
3300031897|Ga0318520_10512434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 741 | Open in IMG/M |
3300031903|Ga0307407_11410195 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300031912|Ga0306921_11294665 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300031941|Ga0310912_10893570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
3300031943|Ga0310885_10918478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 502 | Open in IMG/M |
3300031995|Ga0307409_100999766 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300031996|Ga0308176_12551682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 545 | Open in IMG/M |
3300032002|Ga0307416_100322267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1548 | Open in IMG/M |
3300032004|Ga0307414_11142620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 720 | Open in IMG/M |
3300032005|Ga0307411_10614649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 936 | Open in IMG/M |
3300032008|Ga0318562_10439224 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300032009|Ga0318563_10279947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
3300032025|Ga0318507_10442751 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300032064|Ga0318510_10507657 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300032068|Ga0318553_10542489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 609 | Open in IMG/M |
3300032074|Ga0308173_11334514 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300032074|Ga0308173_11600713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11 | 613 | Open in IMG/M |
3300032143|Ga0315292_11713095 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300032144|Ga0315910_11614994 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300032180|Ga0307471_100453662 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300032205|Ga0307472_102533540 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300032256|Ga0315271_10821465 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300032261|Ga0306920_101075522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1168 | Open in IMG/M |
3300032782|Ga0335082_10284160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1530 | Open in IMG/M |
3300032782|Ga0335082_10446653 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300032782|Ga0335082_11125755 | Not Available | 651 | Open in IMG/M |
3300032829|Ga0335070_10344007 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300032893|Ga0335069_12098821 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300033289|Ga0310914_10306812 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300033406|Ga0316604_10238296 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300033407|Ga0214472_11478492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
3300033418|Ga0316625_100308005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1133 | Open in IMG/M |
3300033418|Ga0316625_101437099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 648 | Open in IMG/M |
3300033434|Ga0316613_10053736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
3300033481|Ga0316600_10050804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2329 | Open in IMG/M |
3300033482|Ga0316627_101466678 | Not Available | 688 | Open in IMG/M |
3300033482|Ga0316627_101638755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
3300033488|Ga0316621_11212090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300033551|Ga0247830_11733863 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300034147|Ga0364925_0404328 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300034160|Ga0370510_0126372 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.49% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.22% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.22% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.59% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.59% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.27% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.95% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.95% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.63% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.63% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.32% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.32% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.32% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.32% |
Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 0.32% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.32% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.32% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.32% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.32% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.32% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.32% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.32% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.32% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.32% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.32% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.32% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.32% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.32% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003669 | Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Early Sample 3) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034160 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_02566990 | 2199352024 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIIIGTKGFGKT |
deeps_00784720 | 2199352024 | Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDAFLNSSRDDKFVVIGTKGFGK |
ICChiseqgaiiDRAFT_04782623 | 3300000033 | Soil | MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLGLDRDDKFI |
INPhiseqgaiiFebDRAFT_1003943041 | 3300000364 | Soil | MRAWTVDADDIRVAEXFDEALLHRTPEIDSFLRQDRDDKFIVSATKG |
INPhiseqgaiiFebDRAFT_1018231954 | 3300000364 | Soil | MRAWTVDADDIRVAEDFDDALLHRTPEIDAFLNLDRDDKFIVIGTKGFGKTLLLK |
F14TB_1007065421 | 3300001431 | Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGKT |
F14TB_1008980911 | 3300001431 | Soil | MRAWTVDADDIRVAEDFNESLLHHTPEIDGFLRSDRD |
F14TB_1025228811 | 3300001431 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLNLDRDDKFIVIGTKGFGKT |
LSCM4E_10191572 | 3300003669 | Coalbed Water | MRAWTVDADDIRVAEDFDAALLHRTPEIEEFLSHGGEKFVVIGTKGFGKTLLLKAKRVLTQRGG |
Ga0062589_1022067611 | 3300004156 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKTLL |
Ga0066396_100981012 | 3300004267 | Tropical Forest Soil | MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTK |
Ga0063356_1000716751 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIGTKGFGKTLL |
Ga0066395_102944592 | 3300004633 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIAT |
Ga0066395_103576531 | 3300004633 | Tropical Forest Soil | MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTKGFG |
Ga0066395_107332331 | 3300004633 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVI |
Ga0062594_1013158762 | 3300005093 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRQDRDDKFIVIATKG |
Ga0066677_102050612 | 3300005171 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKT |
Ga0066677_103197451 | 3300005171 | Soil | MRAWTVDADDIRVAEDFNDSLLHRTPEIDGFLRSDRDDKFIVIGTKGFGK |
Ga0066688_104274822 | 3300005178 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVI |
Ga0065704_103135001 | 3300005289 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLRPDRDDKFIVIGTKGFGKTL |
Ga0065705_110919821 | 3300005294 | Switchgrass Rhizosphere | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTK |
Ga0070670_1003841881 | 3300005331 | Switchgrass Rhizosphere | MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGK |
Ga0066388_1020191632 | 3300005332 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLLLKA |
Ga0066388_1042820911 | 3300005332 | Tropical Forest Soil | MRAWTVDADDIRVVEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLLLKA |
Ga0068869_1009862962 | 3300005334 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRPDRDDKFIVIGTKGFGKTLL |
Ga0070687_1002226231 | 3300005343 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPARDDKFIVIATKGF |
Ga0070669_1001772473 | 3300005353 | Switchgrass Rhizosphere | MLVASSAGGERMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDD |
Ga0070671_1008542332 | 3300005355 | Switchgrass Rhizosphere | MLVAIECPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLL |
Ga0070673_1020601771 | 3300005364 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFNESLLHRTPEIDAFLRSDRDDKFI |
Ga0070709_117313312 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDKFIVIGTK |
Ga0070713_1004555122 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVEEDFDDSLLHRTPEISAFLRPDRDDKFIVIGT |
Ga0070711_1003195932 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATK |
Ga0070705_1011237741 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVAEDLDQSLLHRTPEIDDFLSPGGEKFVVIGTKG |
Ga0070700_1008428112 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFG |
Ga0070707_1005249002 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIATKG |
Ga0070707_1010094562 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKF |
Ga0070696_1003430702 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGKTL |
Ga0068855_1008640752 | 3300005563 | Corn Rhizosphere | MRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDK |
Ga0066654_105587912 | 3300005587 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTAHRDDKFIVIGTKGF |
Ga0068852_1018900492 | 3300005616 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDDFLRSDRDDK |
Ga0066905_1009139392 | 3300005713 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLNPDRDDKFIVIGTKGFGKTL |
Ga0068861_1001738621 | 3300005719 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGT |
Ga0068861_1009616861 | 3300005719 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKGFGKTL |
Ga0068861_1011897881 | 3300005719 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLERDDKFIVIGTKGF |
Ga0066903_1002764097 | 3300005764 | Tropical Forest Soil | MRPWTVDADDIRAADDFDETLLHRTPEIDAFLAPDR |
Ga0066903_1007354621 | 3300005764 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDALLHRTPEIDAFLSVDRDDKFVVIGTKGFGKTLLL |
Ga0066903_1016511803 | 3300005764 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL |
Ga0066903_1025134591 | 3300005764 | Tropical Forest Soil | MRPWTVDADDIRAADDFDETLLHRTPEIDAFLAPDRDDKFIVIGTKG |
Ga0066903_1027828203 | 3300005764 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIG |
Ga0066903_1060054031 | 3300005764 | Tropical Forest Soil | MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTKGFGKT |
Ga0066903_1070243381 | 3300005764 | Tropical Forest Soil | MRAWTVDADDIRVAADFDDALLHRTPEIDSFLSLERDDKFIVIGTKGFGKTL |
Ga0066903_1085609632 | 3300005764 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHHTPEIDSFLAADRDD |
Ga0074470_116188771 | 3300005836 | Sediment (Intertidal) | MRAWTVDADDIRVAEDFTESLLHRTPEIEAFLRSD |
Ga0068863_1010051801 | 3300005841 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL |
Ga0068860_1009687623 | 3300005843 | Switchgrass Rhizosphere | MRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKT |
Ga0068860_1015521283 | 3300005843 | Switchgrass Rhizosphere | MRAWTVDADDIRVADDFDESLLHRTPEIDGFLTPARHDKFIVIGTKG |
Ga0081540_10226073 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRD |
Ga0075417_100223181 | 3300006049 | Populus Rhizosphere | MRAWTVDADEIRVAEDLDETLLHRTPEIDSFLSLKRDDKF |
Ga0075028_1001632991 | 3300006050 | Watersheds | MRAWTVDADDIQVAEDFNESLLHRTTEIESFLRSDRDDKFIVIGTKGFGKT |
Ga0075017_1004512352 | 3300006059 | Watersheds | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTL |
Ga0070715_108346071 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVADDFDDSLLHRTPEIDGFLTPSRDDKFIVIATKGF |
Ga0070716_1013178611 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKTLL |
Ga0097621_1019643002 | 3300006237 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPG |
Ga0068871_1019356562 | 3300006358 | Miscanthus Rhizosphere | MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIGTK |
Ga0075421_1006599001 | 3300006845 | Populus Rhizosphere | MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIG |
Ga0075421_1009300431 | 3300006845 | Populus Rhizosphere | MCHAPRNAAMRAWTVDADDIRVAEDFDEALLHRTPEIDGFLSLDRDDKFIVIGTKGFGKT |
Ga0075430_1013524901 | 3300006846 | Populus Rhizosphere | MRAWTVDADDIRVAEDLDEALLHRTPEIDSFLSLDRDDKFIVIGTKGFGKTL |
Ga0075424_1006677161 | 3300006904 | Populus Rhizosphere | MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIA |
Ga0075419_101745223 | 3300006969 | Populus Rhizosphere | MRAWTVDADDIRVAEDFDDALLHRTPEIDNFLTFDRD |
Ga0066710_1024463472 | 3300009012 | Grasslands Soil | VDADDIRVAEDFDETLLHRTPEIDSFLNLERDDKFIVIGTKGFGRRCC |
Ga0105099_103605261 | 3300009082 | Freshwater Sediment | MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDREDKF |
Ga0099827_103462251 | 3300009090 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPD |
Ga0111539_102186892 | 3300009094 | Populus Rhizosphere | MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSD |
Ga0079224_1019481811 | 3300009095 | Agricultural Soil | MRAWTVDADDIRVAEDFDAALLHRTPEIEEFLSLGGDKFVV |
Ga0075418_119380211 | 3300009100 | Populus Rhizosphere | MRAWTVDADDIRVAEDFDEALLHHTPEIDSFLNLERDDKF |
Ga0105247_109637752 | 3300009101 | Switchgrass Rhizosphere | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGT |
Ga0099792_109152801 | 3300009143 | Vadose Zone Soil | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDR |
Ga0105243_103438671 | 3300009148 | Miscanthus Rhizosphere | MRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTLL |
Ga0105243_109990582 | 3300009148 | Miscanthus Rhizosphere | MRAWTVDADDIHVAEDFDASLPHRTPEIDTFLSPDRDDKFIV |
Ga0105243_127566541 | 3300009148 | Miscanthus Rhizosphere | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRD |
Ga0111538_104132941 | 3300009156 | Populus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKT |
Ga0105092_107218182 | 3300009157 | Freshwater Sediment | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDQFIVIGTK |
Ga0075423_105859561 | 3300009162 | Populus Rhizosphere | MRAWTVDADDIRVAEDFDDALLHRTPEIDNFLTFDRDDKFIVI |
Ga0105101_106593972 | 3300009171 | Freshwater Sediment | MRAWTVDADDIRVAEDFDDALLHRTPEIDAFLTPD |
Ga0105242_107638762 | 3300009176 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGK |
Ga0105248_101750794 | 3300009177 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLLHK |
Ga0105248_101932741 | 3300009177 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKG |
Ga0105248_112134661 | 3300009177 | Switchgrass Rhizosphere | MLVAIECPEEVAMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLL |
Ga0105066_10858872 | 3300009822 | Groundwater Sand | MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL |
Ga0131092_109491631 | 3300009870 | Activated Sludge | MRAWTVDADDIRVAEDFDAAVLHRTPEIEEFLSPGG |
Ga0105074_10736481 | 3300010029 | Groundwater Sand | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTK |
Ga0126384_121051622 | 3300010046 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDHDDKF |
Ga0126384_121956612 | 3300010046 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDTFLSLD |
Ga0126382_102651382 | 3300010047 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDDFLTRDRD |
Ga0126370_106170943 | 3300010358 | Tropical Forest Soil | MRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGT |
Ga0126370_113521162 | 3300010358 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKGFGKT |
Ga0126370_114055752 | 3300010358 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDR |
Ga0126376_101030911 | 3300010359 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLLK |
Ga0126376_109225771 | 3300010359 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDALLHRTPEIDGFLSPDRDDKFIV |
Ga0126372_114755421 | 3300010360 | Tropical Forest Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTLL |
Ga0126372_116051731 | 3300010360 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKT |
Ga0126372_131026031 | 3300010360 | Tropical Forest Soil | MRAWTVDADDIRVAEDFSDSLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTLL |
Ga0126378_129540312 | 3300010361 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPD |
Ga0126377_100680763 | 3300010362 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIA |
Ga0126379_106419032 | 3300010366 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIA |
Ga0126379_118772232 | 3300010366 | Tropical Forest Soil | MRAWTVDADDVRVAEDFDDALLHRTPEIDTFLNLDRDDKFIVIGTKGFGK |
Ga0126379_120448522 | 3300010366 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIATKGFGK |
Ga0126379_122237962 | 3300010366 | Tropical Forest Soil | MRAWTVDADDIRVAADLDDALLHRTPEIDSFLSLKRDDKFIVIGTKGF |
Ga0134128_118239962 | 3300010373 | Terrestrial Soil | MHAWTVDADDIRVADDFNDSLLHRTPEIDGFLRSDREDKFVIIGTKGFGKT |
Ga0134124_102558342 | 3300010397 | Terrestrial Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRQDRD |
Ga0126383_118402611 | 3300010398 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDESLLHHTPEIDSFLNSDRDDKFIVIGTKGFGKTL |
Ga0126383_120552011 | 3300010398 | Tropical Forest Soil | MRAWTVDADDIRVAGDFDESLLHRTPEIETFLNPDRDDKFIVIGTK |
Ga0134127_121888122 | 3300010399 | Terrestrial Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLAPDRDDKFIVIATK |
Ga0134122_115473681 | 3300010400 | Terrestrial Soil | MRSWTVDADDIKIAEDFDDALLHKPPWLEAFLSAGGDEKFIVIGTKGFGKTLLLKA |
Ga0134121_112624922 | 3300010401 | Terrestrial Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTKGFGK |
Ga0118733_1087671082 | 3300010430 | Marine Sediment | MRPWTIDADDIRIADDFDDQLLHRTPWIEDFLDPRDDKFIVVATKGFGKTLL |
Ga0105246_123481141 | 3300011119 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIIIGTK |
Ga0137391_110105361 | 3300011270 | Vadose Zone Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDK |
Ga0137382_102381842 | 3300012200 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVIGTKDSARRCC* |
Ga0137363_105137871 | 3300012202 | Vadose Zone Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKT |
Ga0137386_104730122 | 3300012351 | Vadose Zone Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGK |
Ga0137367_101701343 | 3300012353 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDD |
Ga0137369_100798101 | 3300012355 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFIVIGTKGFGKTL |
Ga0137384_101492743 | 3300012357 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGK |
Ga0137375_102670293 | 3300012360 | Vadose Zone Soil | VDADDIRVADDFDESLLHRTPEIESFLTPDRDDKFIVIATKGFGKTLLLKAIAHGIT |
Ga0137361_107108563 | 3300012362 | Vadose Zone Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIGTKGFGKT |
Ga0157321_10183052 | 3300012487 | Arabidopsis Rhizosphere | MRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDR |
Ga0137358_103685693 | 3300012582 | Vadose Zone Soil | MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTK |
Ga0137358_105826802 | 3300012582 | Vadose Zone Soil | MRAWTLDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATK |
Ga0157292_103210111 | 3300012900 | Soil | MLVASSAGGERMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKT |
Ga0137394_102235231 | 3300012922 | Vadose Zone Soil | MRAWTVDADDIRVAEDLDDALLHHTPEIDSFLNLD |
Ga0137394_110660691 | 3300012922 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKF |
Ga0137359_105027441 | 3300012923 | Vadose Zone Soil | MRAWTVDADDIRVAEDFNESLLHRTPEIDGFLSSDRDDKFIVIGTKGFGKTLLLK |
Ga0137404_109332972 | 3300012929 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDESLLHRTAEIDNFLAPDRDDKFIIIGTKG |
Ga0126375_105521812 | 3300012948 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVI |
Ga0126375_113864871 | 3300012948 | Tropical Forest Soil | MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLL |
Ga0126369_120949022 | 3300012971 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRD |
Ga0126369_122229501 | 3300012971 | Tropical Forest Soil | MRAWTVDADDIRVAGDFNESLLHRTPEIDSFLRSDRDDKFIVIGTKD |
Ga0126369_122435832 | 3300012971 | Tropical Forest Soil | MRAWTVDADDIRVADDFDDTLLHRTPEIDGFLSSDRDDKFIVIGT |
Ga0126369_133984661 | 3300012971 | Tropical Forest Soil | MRAWTVDADDIRVADDFNESLLHRTPEIEAFLRSDRDDKFIVIGTKGFGKTLL |
Ga0164305_105490741 | 3300012989 | Soil | MRAWTVDAYYIRVAEDFNESLLHRTPEIDAFLRSDRDDKF |
Ga0157371_101396461 | 3300013102 | Corn Rhizosphere | MHAWTVDADDIRVADDFNDSLLHRTPEIDGFLRSDREDKFVIIGTK |
Ga0157369_108881482 | 3300013105 | Corn Rhizosphere | MRAWTVDADDIRVADDFDESLLHRTPEIDDFLRSDRDDKFIVIGTKGF |
Ga0157378_117158231 | 3300013297 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLSPGRDDKFIVIGTKGFGKT |
Ga0157372_100247696 | 3300013307 | Corn Rhizosphere | MRAWTVGADAIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTKGFGKTLLL |
Ga0157372_101929261 | 3300013307 | Corn Rhizosphere | MRAWTVDADDIRVADDFDESLLHRTPEIDAFLNSSRDDKFVVIGTKGFGKTL |
Ga0157372_112910762 | 3300013307 | Corn Rhizosphere | MRAWTVDADDIRVAEDFNESLLHRTPEIDAFLRSDRDDKFIVIGT |
Ga0163163_114573832 | 3300014325 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPDRDD |
Ga0163163_115092481 | 3300014325 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDK |
Ga0157380_106007752 | 3300014326 | Switchgrass Rhizosphere | MLVAIQCPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGF |
Ga0157380_135496791 | 3300014326 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLGLDRDDKFIVIGTKGFGKTLL |
Ga0182021_112389413 | 3300014502 | Fen | MRPWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDD |
Ga0157379_106113821 | 3300014968 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTL |
Ga0157379_117842951 | 3300014968 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPARDDKFIVIATK |
Ga0137418_103045703 | 3300015241 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIV |
Ga0132258_105172541 | 3300015371 | Arabidopsis Rhizosphere | MRAWTVDADDIRVADDFDDSLLHRTPEIDGFLTPSRDDKFIVIATK |
Ga0132258_106630626 | 3300015371 | Arabidopsis Rhizosphere | MRAWTVDADDIRVAEDFNESLLHRTPEIDGFLSSDRDDKFIVIGTKGFG |
Ga0132258_131479923 | 3300015371 | Arabidopsis Rhizosphere | MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGK |
Ga0132256_1012931992 | 3300015372 | Arabidopsis Rhizosphere | MRAWTVDADDIQVAEDLSARDLHQTPGIEAFLAPQRGDKFIVVATKGFGKTLLLKA |
Ga0132256_1019344631 | 3300015372 | Arabidopsis Rhizosphere | MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIATKGFGKT |
Ga0132257_1013657161 | 3300015373 | Arabidopsis Rhizosphere | MRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIV |
Ga0132257_1018401552 | 3300015373 | Arabidopsis Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPD |
Ga0132257_1026439762 | 3300015373 | Arabidopsis Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGFGK |
Ga0132257_1042514931 | 3300015373 | Arabidopsis Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDKFIV |
Ga0132255_1024869262 | 3300015374 | Arabidopsis Rhizosphere | MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKFIVIGT |
Ga0132255_1060151131 | 3300015374 | Arabidopsis Rhizosphere | MRAWTVDADDIRVADDFDESLLHRTPEIDGFLSSDRDDKFVVIGTKGFGKT |
Ga0182035_106841701 | 3300016341 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIV |
Ga0182035_109079992 | 3300016341 | Soil | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLGSDRDDKFIVIGTKGFGK |
Ga0182034_107403091 | 3300016371 | Soil | MRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDRDDKF |
Ga0182039_102965853 | 3300016422 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKF |
Ga0163161_100216111 | 3300017792 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTK |
Ga0190266_102885741 | 3300017965 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTL |
Ga0190266_113421531 | 3300017965 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKF |
Ga0184604_103455851 | 3300018000 | Groundwater Sediment | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIGTKG |
Ga0187766_108917352 | 3300018058 | Tropical Peatland | MRAWTVDADDIRVVEDFDESLLCRTPEIDSFLTPD |
Ga0187765_105164122 | 3300018060 | Tropical Peatland | MRAWTVDADDIRVAEDFDESLLHHTPEIDGFLRSDRDD |
Ga0184618_100436312 | 3300018071 | Groundwater Sediment | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVI |
Ga0184629_100339893 | 3300018084 | Groundwater Sediment | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDD |
Ga0184629_106928482 | 3300018084 | Groundwater Sediment | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDD |
Ga0193723_11055642 | 3300019879 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVI |
Ga0206353_118416511 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFI |
Ga0163149_104722332 | 3300020596 | Freshwater Microbial Mat | MRAWTVDADDIRVAEDFDAGLLHRTPEIDDFLSPGGEKFVVIGTK |
Ga0210380_102655332 | 3300021082 | Groundwater Sediment | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIG |
Ga0210404_106942852 | 3300021088 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFI |
Ga0210406_112133192 | 3300021168 | Soil | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKCIVIGTKGFGKTLLLK |
Ga0210400_100217306 | 3300021170 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIV |
Ga0210397_111978691 | 3300021403 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGF |
Ga0182009_101683552 | 3300021445 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLL |
Ga0210390_106740751 | 3300021474 | Soil | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGK |
Ga0126371_105902513 | 3300021560 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATK |
Ga0126371_129204582 | 3300021560 | Tropical Forest Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTK |
Ga0222623_102260292 | 3300022694 | Groundwater Sediment | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLGVDRDDKFIV |
Ga0247796_10474121 | 3300023261 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFV |
Ga0124853_11601091 | 3300024056 | Freshwater Wetlands | MRAWTVDADDIRVAADFNEALLHRTPEIEGFLRADRDDKFIIIGTKGF |
Ga0207656_106335402 | 3300025321 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGF |
Ga0207645_110868181 | 3300025907 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDNFLTPGHDDKFVVIGT |
Ga0207707_107244701 | 3300025912 | Corn Rhizosphere | MHAWTVDADDIRVADDFNDSLLHRTPEIDAFLRSDRDDKFVIIGTKGFGKTL |
Ga0207663_109984522 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFSESLLHRTPEIEGFLRSDRDDKFIVIGTKGFG |
Ga0207663_110380882 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTLLL |
Ga0207660_117241562 | 3300025917 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTL |
Ga0207649_108287311 | 3300025920 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLLL |
Ga0207649_114724732 | 3300025920 | Corn Rhizosphere | MRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKG |
Ga0207681_106201852 | 3300025923 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRD |
Ga0207694_101205323 | 3300025924 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPDRDDKFIVI |
Ga0207701_114346942 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAWTVDADDIRVADDFDDSLLHRTPEIDAFLTESRDDKFIVIATKGFGKTLLL |
Ga0207644_107792692 | 3300025931 | Switchgrass Rhizosphere | MRAWTVDADDIRVADDFDDSLLHRTPEIDAFLTESR |
Ga0207706_103450232 | 3300025933 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFG |
Ga0207709_105008412 | 3300025935 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDD |
Ga0207704_108014762 | 3300025938 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKG |
Ga0207711_101221654 | 3300025941 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDK |
Ga0207711_103876042 | 3300025941 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPD |
Ga0207711_117697471 | 3300025941 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDD |
Ga0207679_113641572 | 3300025945 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLAPGRDDKFIVIGTKGFGKTLLL |
Ga0207640_113709401 | 3300025981 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDTFVVI |
Ga0207658_100181721 | 3300025986 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKGFGKTLL |
Ga0207658_103711892 | 3300025986 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTK |
Ga0207677_100328841 | 3300026023 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVI |
Ga0207677_122325541 | 3300026023 | Miscanthus Rhizosphere | MRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDKFIVIGTKGF |
Ga0207641_101519673 | 3300026088 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRD |
Ga0207641_108649082 | 3300026088 | Switchgrass Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIA |
Ga0207641_122604172 | 3300026088 | Switchgrass Rhizosphere | VASGSLEECMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIAT |
Ga0207674_110526732 | 3300026116 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGF |
Ga0207683_101416711 | 3300026121 | Miscanthus Rhizosphere | MLVAIQCPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGK |
Ga0207683_109001991 | 3300026121 | Miscanthus Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLSLD |
Ga0207698_103789741 | 3300026142 | Corn Rhizosphere | MRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKF |
Ga0207698_113499671 | 3300026142 | Corn Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGF |
Ga0209057_12326471 | 3300026342 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLLKA |
Ga0257180_10058572 | 3300026354 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFI |
Ga0257152_10293861 | 3300026369 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRD |
Ga0257160_10359762 | 3300026489 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKG |
Ga0209056_100835863 | 3300026538 | Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDD |
Ga0209897_10060774 | 3300027169 | Groundwater Sand | MRAWTVDADDIRVAEDFDDALLHRTPEIDGFLTLDRDDKFIVIGTKGFGKTLL |
Ga0209854_10221462 | 3300027384 | Groundwater Sand | MRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFI |
Ga0209874_10116225 | 3300027577 | Groundwater Sand | MRAWTVDADDIRVAEDFDDALLHRTPEIDNFLNLDRDDKF |
Ga0209799_11393321 | 3300027654 | Tropical Forest Soil | MRAWTVDADDIRVAADFDDALLHRTPEIDSFLSLERDDKFIVIGTKGFGKTLLLKA |
Ga0209328_101601921 | 3300027727 | Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPG |
Ga0209177_101576951 | 3300027775 | Agricultural Soil | MRAWTVDADDIRVAADFDEALLHRTPEIDSFLSVER |
Ga0209180_106155851 | 3300027846 | Vadose Zone Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVI |
Ga0209668_101183302 | 3300027899 | Freshwater Lake Sediment | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFI |
Ga0209382_105403462 | 3300027909 | Populus Rhizosphere | MRAWTVDADDIHVAEDFDASLLHRTPEIDAFLSPDRDDKFIVIG |
Ga0209583_1000005637 | 3300027910 | Watersheds | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLAPERDDKFIVTGTKGFGKTLL |
(restricted) Ga0233417_106392132 | 3300028043 | Sediment | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLNPDRDDQFVVIGTKGFG |
Ga0307283_101911771 | 3300028790 | Soil | MRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDD |
Ga0302254_101085141 | 3300028870 | Fen | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVIGTKGFGKTLLL |
Ga0307278_103593431 | 3300028878 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTL |
Ga0311329_106113373 | 3300029907 | Bog | MRAWTVDADDIQVAEDFDESLLHRTPEIDGFLRSDRDGKFIVIGTKGFGKTLLLK |
Ga0311334_118436951 | 3300029987 | Fen | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGT |
Ga0311365_118529321 | 3300029989 | Fen | MRAWTVDADDIRVAEDFDETLLHRTPEIDSFLAPDRDDKFIVIGT |
Ga0311336_102499611 | 3300029990 | Fen | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIV |
Ga0311348_102892542 | 3300030019 | Fen | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIV |
Ga0311360_108434522 | 3300030339 | Bog | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIG |
Ga0311335_106662652 | 3300030838 | Fen | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGF |
Ga0170824_1172682381 | 3300031231 | Forest Soil | MRAWTVDADDIRVAEDFDDSLLHRTPEIDAFLTPGRD |
Ga0302323_1004190683 | 3300031232 | Fen | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRD |
Ga0302323_1030493711 | 3300031232 | Fen | MRAWTVDADDIRVAEDFDETLLHRTPEIDSFLAPDR |
Ga0310886_103846871 | 3300031562 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPDR |
Ga0318555_102159033 | 3300031640 | Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGFGKT |
Ga0318555_103992471 | 3300031640 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLD |
Ga0310813_120012171 | 3300031716 | Soil | MRPWTIDADDIQVAEDFDASLLHRTNWIDDFLAHGRDERFIVTGTKGFGKTL |
Ga0307469_117913702 | 3300031720 | Hardwood Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRPDRDDKFIV |
Ga0302321_1028476922 | 3300031726 | Fen | MRAWTVDADDIRVADDLDEALLHRTPEIEAFLSPE |
Ga0307516_103677902 | 3300031730 | Ectomycorrhiza | MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDREDKFIV |
Ga0307405_102605133 | 3300031731 | Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDD |
Ga0307468_1006901391 | 3300031740 | Hardwood Forest Soil | MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTKG |
Ga0307468_1009099482 | 3300031740 | Hardwood Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDK |
Ga0307468_1010292271 | 3300031740 | Hardwood Forest Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDDFLTRDRDDKFIVIGTKGFGKTL |
Ga0307468_1016126442 | 3300031740 | Hardwood Forest Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDAFLAPS |
Ga0318521_104542702 | 3300031770 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKG |
Ga0318529_104553222 | 3300031792 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRNDKFI |
Ga0318568_105231442 | 3300031819 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKGF |
Ga0307473_100557482 | 3300031820 | Hardwood Forest Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIG |
Ga0307473_101334901 | 3300031820 | Hardwood Forest Soil | MRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLD |
Ga0307473_110339781 | 3300031820 | Hardwood Forest Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLNLERDD |
Ga0307413_112819902 | 3300031824 | Rhizosphere | MRAWTVDADDIRVAEDFDDALLHRTPEIEGFLTPGS |
Ga0318520_105124341 | 3300031897 | Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDAFLTPGRDDKF |
Ga0307407_114101951 | 3300031903 | Rhizosphere | MRAWTVDADDIRIAEDFDESLLHRTPEIDAFLRSDRDEKFI |
Ga0306921_112946652 | 3300031912 | Soil | MRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDR |
Ga0310912_108935701 | 3300031941 | Soil | MRAWTVDADDIQVAEDFNESLLHRTPEIDGFLRSDRDDKFIV |
Ga0310885_109184781 | 3300031943 | Soil | MRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIG |
Ga0307409_1009997661 | 3300031995 | Rhizosphere | MRAWTVDADDIRVAEDFDEALLHRTPEIDSFLNLERDDKFIVIG |
Ga0308176_125516822 | 3300031996 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIVAFLTPDRDDKFI |
Ga0307416_1003222673 | 3300032002 | Rhizosphere | MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDRDDKFIVIGTKGFGKTLL |
Ga0307414_111426202 | 3300032004 | Rhizosphere | MRAWTVDADDIRIAEDFDESLLHRTPEIDAFLRSDRDEKFIVIGTK |
Ga0307411_106146491 | 3300032005 | Rhizosphere | MRAWTVDADDIHVADDFDESLLHRTPEIDGFLRLDRDD |
Ga0318562_104392242 | 3300032008 | Soil | MRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDRDDKFIVIG |
Ga0318563_102799471 | 3300032009 | Soil | MRAWTVDADDIQVAEDFNESLLHRTAEIEGFLHSDRDD |
Ga0318507_104427512 | 3300032025 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFI |
Ga0318510_105076571 | 3300032064 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKG |
Ga0318553_105424892 | 3300032068 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIVIGTK |
Ga0308173_113345142 | 3300032074 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVV |
Ga0308173_116007132 | 3300032074 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLLL |
Ga0315292_117130952 | 3300032143 | Sediment | MRAWTVDADDIRVAEDFNESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKT |
Ga0315910_116149942 | 3300032144 | Soil | MRAWTVDADDIRVTEDFDDSLLHRTPEIEAFLRSDRDDKFIVIGTKGFGKTLLL |
Ga0307471_1004536623 | 3300032180 | Hardwood Forest Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDD |
Ga0307472_1025335401 | 3300032205 | Hardwood Forest Soil | MRAWTVDADDIRVAEDFDDALLHETPEITSFLNLDG |
Ga0315271_108214651 | 3300032256 | Sediment | MRAWTVDADDIRVADDFDESLLHRTPEIDGFLSPGRDDKFIVIGTKGF |
Ga0306920_1010755221 | 3300032261 | Soil | MRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTL |
Ga0335082_102841602 | 3300032782 | Soil | MKAWTVDADDIRVTEDFDESLLHRTPEIDDFLSQDRDDKFV |
Ga0335082_104466532 | 3300032782 | Soil | MRAWTVDADDIRVAEDFNESLLHRTPEIEGFLRSDRD |
Ga0335082_111257551 | 3300032782 | Soil | MRAWTVDADDIRVAEDFDDTLLHRTPEIDAFLSPERDDKFVVIGTKGF |
Ga0335070_103440071 | 3300032829 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPNRDDKFIVIGTK |
Ga0335069_120988211 | 3300032893 | Soil | MRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKTL |
Ga0310914_103068123 | 3300033289 | Soil | MRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRD |
Ga0316604_102382962 | 3300033406 | Soil | MRAWTVDADDIRVAEDFDEALLHRTVEIDAFLTPGRDDKFIVIGTKGF |
Ga0214472_114784921 | 3300033407 | Soil | MRAWTVDADDIRVAEDFDAALLHRTPEIDEFLSHGGEKFVVVGTK |
Ga0316625_1003080052 | 3300033418 | Soil | MRAWTVDADDIRVAEDFDDTLLHRTPEIDAFLTPDRDDKFIVIGTK |
Ga0316625_1014370992 | 3300033418 | Soil | MRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKT |
Ga0316613_100537361 | 3300033434 | Soil | MRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDQF |
Ga0316600_100508041 | 3300033481 | Soil | MRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKTL |
Ga0316627_1014666782 | 3300033482 | Soil | MRAWTVDADDIRVAEDFDETLLHRTAEIDVFLTPGRDDKFIVI |
Ga0316627_1016387552 | 3300033482 | Soil | MRAWTVDADDIRVAEDFDETLLHRTPEIEAFLAPDREDKFIVIGTKGFGKTL |
Ga0316621_112120901 | 3300033488 | Soil | MRAWTVDADDIRVAEDFDESLLHRTPEIEAFLSPDREDKFIV |
Ga0247830_117338631 | 3300033551 | Soil | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGK |
Ga0364925_0404328_2_115 | 3300034147 | Sediment | MRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDD |
Ga0370510_0126372_621_779 | 3300034160 | Untreated Peat Soil | MRAWTVDADDIRVADDFDDSLLHRTPEIDAFLSPDRDDKFIVVGTKGFGKTLL |
⦗Top⦘ |