Scaffold Ga0130078_12980211

Overview

Basic Information

• Taxon OID: 3300009869
• Scaffold ID: Ga0130078_12980211
• Source Dataset Name: Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Corn Stover. Combined Assembly of Gp0148673, Gp0148674
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: U.S. Department of Energy (DOE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 978
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctnPP24 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Cow Rumen Metatranscriptome

Source Dataset Sampling Location

• Location Name: University of Illinois at Urbana - Champaign, Illinois, USA
• Coordinates
  • Lat. (^o): 40.096
  • Long. (^o): -88.2315

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0130078_129802113	F036964	AGGAGG	MNNIVDILKVVFPALMVTGAAGSLIVNICTKGDWPVSLQWFGAALLYTA