NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130078_12822065

Scaffold Ga0130078_12822065


Overview

Basic Information
Taxon OID3300009869 Open in IMG/M
Scaffold IDGa0130078_12822065 Open in IMG/M
Source Dataset NameCow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Corn Stover. Combined Assembly of Gp0148673, Gp0148674
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterU.S. Department of Energy (DOE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Cow Rumen Metatranscriptome

Source Dataset Sampling Location
Location NameUniversity of Illinois at Urbana - Champaign, Illinois, USA
CoordinatesLat. (o)40.096Long. (o)-88.2315Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021693Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0130078_128220651F021693N/AMNSRFVTVMLVAVVAALAVAEPVVKVRKGATPLYNEKPNTFRVETSFRVEEEPGEDARERLVQVTESLPPQVTLISGELAHKLVVKTVEVDAAPLDGWTNLEYVVCADKVKFTLRNLTYDVLIRPTRFSVHETKAEDSEVITSEVSEFVTLRTHFPIRKATLFADFPYLTPCVYGIAIVLPVLLAMFFVKVCAARPKVKAN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.