| Basic Information | |
|---|---|
| Taxon OID | 3300009865 Open in IMG/M |
| Scaffold ID | Ga0131956_100035587 Open in IMG/M |
| Source Dataset Name | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1T |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 758 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 27.4 | Long. (o) | -93.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031354 | Metagenome / Metatranscriptome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131956_1000355872 | F031354 | AGGAG | LKTTIDINDILYPIINVASVKTTIDGGVYRNKKPLNSELRDIVIIPLSNYVGDEIMNEATFMVNCYCKNFTNGTPDITKLRAIVNAVVAVIEAYNNTSNYYIFEITNQILLQD |
| ⦗Top⦘ |