3300009865: Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1T

Overview

Basic Information

• IMG/M Taxon OID: 3300009865
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111382 | Gp0149174 | Ga0131956
• Sample Name: Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1T
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 317411907
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine cold seep biome → cold seep → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.4
  • Long. (^o): -93.2
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031354	Metagenome / Metatranscriptome	182	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0131956_100035587	Not Available	758

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0131956_100035587	Ga0131956_1000355872	F031354	LKTTIDINDILYPIINVASVKTTIDGGVYRNKKPLNSELRDIVIIPLSNYVGDEIMNEATFMVNCYCKNFTNGTPDITKLRAIVNAVVAVIEAYNNTSNYYIFEITNQILLQD