| Basic Information | |
|---|---|
| Taxon OID | 3300009847 Open in IMG/M |
| Scaffold ID | Ga0118745_104521 Open in IMG/M |
| Source Dataset Name | Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - SF2CT |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 939 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls → Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lacaze-Duthiers Canyon | |||||||
| Coordinates | Lat. (o) | 42.4666667 | Long. (o) | 3.4666667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057039 | Metagenome / Metatranscriptome | 136 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118745_1045211 | F057039 | N/A | VGSKMMVHVLGWEWIFQMDVVGVVIVVEVKGRDNLELSMEDTQENNEDIVDGSHKFLSNLVANIVFEVEMDNVAKGKVCSSYF* |
| ⦗Top⦘ |