| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009847 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118233 | Gp0131530 | Ga0118745 |
| Sample Name | Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - SF2CT |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 40238430 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls → Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → wood |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lacaze-Duthiers Canyon | |||||||
| Coordinates | Lat. (o) | 42.4666667 | Long. (o) | 3.4666667 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011735 | Metagenome / Metatranscriptome | 287 | Y |
| F057039 | Metagenome / Metatranscriptome | 136 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0118745_104521 | Not Available | 939 | Open in IMG/M |
| Ga0118745_111385 | Not Available | 620 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0118745_104521 | Ga0118745_1045211 | F057039 | VGSKMMVHVLGWEWIFQMDVVGVVIVVEVKGRDNLELSMEDTQENNEDIVDGSHKFLSNLVANIVFEVEMDNVAKGKVCSSYF* |
| Ga0118745_111385 | Ga0118745_1113852 | F011735 | PYIVKRVLQKGAYELVDYEGNPLDKPRNGLYLKKYYA* |
| ⦗Top⦘ |