Scaffold Ga0131972_13654

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0131972_13654

Scaffold Ga0131972_13654

Overview

Basic Information
Taxon OID	3300009842 Open in IMG/M
Scaffold ID	Ga0131972_13654 Open in IMG/M
Source Dataset Name	Bacterial communities in Amundsen Sea Polynya. Combined Assembly of Gp0149108, Gp0149160, Gp0151052
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Macrogen Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	34794
Total Scaffold Genes	26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (15.38%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Metagenomic Analysis Of Heterotrophic Bacteria Associated With Phytoplankton Bloom In Amundsen Sea Polynya

Source Dataset Sampling Location
Location Name	Polynya in Amundsen Sea
Coordinates	Lat. (^o)	-73.3	Long. (^o)	-113.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013024	Metagenome / Metatranscriptome	275	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0131972_1365415	F013024	N/A	MEKPATKFIATKLFWLGVIGTYILAGVLLNRLETNAGYEELRFTSLIPTLFYFFILFLSYRSFKTQAVRTTILQFVTQMLLLLPLMAMYMAVILFTTKFSS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.