Basic Information | |
---|---|
Taxon OID | 3300009842 Open in IMG/M |
Scaffold ID | Ga0131972_12746 Open in IMG/M |
Source Dataset Name | Bacterial communities in Amundsen Sea Polynya. Combined Assembly of Gp0149108, Gp0149160, Gp0151052 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Macrogen Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 160728 |
Total Scaffold Genes | 142 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 96 (67.61%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Metagenomic Analysis Of Heterotrophic Bacteria Associated With Phytoplankton Bloom In Amundsen Sea Polynya |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Polynya in Amundsen Sea | |||||||
Coordinates | Lat. (o) | -73.3 | Long. (o) | -113.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063090 | Metagenome / Metatranscriptome | 130 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0131972_1274661 | F063090 | GGA | MIKLMTLVMALSMPLTALATDAIDKKLALSCTESLFLKGLDGVLKGYPGIAYPPTWQQGTGPYTYESRYDVSQTKRGKNELCAKYYGFVRPSQVSGNGKQANCKTNITGIKVILKSKAELALKDHQPFVCYFKDGSDITRDSYNFHSAWTAELLRP* |
⦗Top⦘ |