Scaffold Ga0131972_11832

Overview

Basic Information

• Taxon OID: 3300009842
• Scaffold ID: Ga0131972_11832
• Source Dataset Name: Bacterial communities in Amundsen Sea Polynya. Combined Assembly of Gp0149108, Gp0149160, Gp0151052
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Macrogen Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5378
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Metagenomic Analysis Of Heterotrophic Bacteria Associated With Phytoplankton Bloom In Amundsen Sea Polynya

Source Dataset Sampling Location

• Location Name: Polynya in Amundsen Sea
• Coordinates
  • Lat. (^o): -73.3
  • Long. (^o): -113.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006403	Metagenome / Metatranscriptome	374	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131972_118323	F006403	N/A	LLIGRAFILLITKDIERKAIIKKAKKTIPNDLKLDFRFKTCFVEMIXXXXXXXX