| Basic Information | |
|---|---|
| Taxon OID | 3300009842 Open in IMG/M |
| Scaffold ID | Ga0131972_11540 Open in IMG/M |
| Source Dataset Name | Bacterial communities in Amundsen Sea Polynya. Combined Assembly of Gp0149108, Gp0149160, Gp0151052 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Macrogen Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5375 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Metagenomic Analysis Of Heterotrophic Bacteria Associated With Phytoplankton Bloom In Amundsen Sea Polynya |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Polynya in Amundsen Sea | |||||||
| Coordinates | Lat. (o) | -73.3 | Long. (o) | -113.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004613 | Metagenome / Metatranscriptome | 431 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131972_115402 | F004613 | N/A | MVSDVTKKLNLSTEDLKRQKNIISKLNLAKLPFDISPDRMCALNLEMARHSSAVLKYQEDKSGIKWIFSSIKKYKVFLIIFESNELGEEIYKEKISSKLPEYSYKTVAQIVDDGVKKNFFIKLNARAKTTKDLKIRNVRPSEEVIIEFINWKIDLLASLMKFKKDLIN* |
| ⦗Top⦘ |