Scaffold Ga0118743_110499

Overview

Basic Information

• Taxon OID: 3300009841
• Scaffold ID: Ga0118743_110499
• Source Dataset Name: Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - SF1CC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls → Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France

Source Dataset Sampling Location

• Location Name: Lacaze-Duthiers Canyon
• Coordinates
  • Lat. (^o): 42.4666667
  • Long. (^o): 3.4666667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028713	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118743_1104992	F028713	GAGG	MIEEKKILLVKVDTLKNTVDALTKYVSSEKFSWCRETMGVSGLKK*