3300009841: Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - SF1CC

Overview

Basic Information

• IMG/M Taxon OID: 3300009841
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118233 | Gp0131528 | Ga0118743
• Sample Name: Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - SF1CC
• Sequencing Status: Permanent Draft
• Sequencing Center: Molecular Research LP (MR DNA)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 16078057
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls → Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine benthic biome → marine benthic feature → wood
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Lacaze-Duthiers Canyon
• Coordinates
  • Lat. (^o): 42.4666667
  • Long. (^o): 3.4666667
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028713	Metagenome / Metatranscriptome	190	Y
F057039	Metagenome / Metatranscriptome	136	Y
F078089	Metagenome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118743_102405	Not Available	1084
Ga0118743_103348	Not Available	927
Ga0118743_110499	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca	502

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118743_102405	Ga0118743_1024052	F057039	WEWIFQMDVVGVVIVVEVKGRDNLELSMEDTQENNEDIVDGSHKFLSNLVANIVFEVEMDNVAKGKVCSSYF*
Ga0118743_103348	Ga0118743_1033481	F078089	MGLPEGKIIEQAYVILLKLDKNKEVLVNNDWGKIGKKT*
Ga0118743_110499	Ga0118743_1104992	F028713	MIEEKKILLVKVDTLKNTVDALTKYVSSEKFSWCRETMGVSGLKK*