Scaffold Ga0116170_10651397

Overview

Basic Information

• Taxon OID: 3300009694
• Scaffold ID: Ga0116170_10651397
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 552
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 35.92
  • Long. (^o): 139.63

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089576	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116170_106513972	F089576	GAG	MFGLPEITIFAVGGVVLVVTAALLYWGLTFRRHD*