| Basic Information | |
|---|---|
| Taxon OID | 3300009591 Open in IMG/M |
| Scaffold ID | Ga0105155_1054502 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_130316 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 671 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Nevada, Gerlach, Sandy's Spring West | |||||||
| Coordinates | Lat. (o) | 40.653 | Long. (o) | -119.3749 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088087 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105155_10545022 | F088087 | GAGG | MMMMLKVTDGSVWKEVGVSKSSCEICGRKGSARIYECVEGKWAGVRVVACPEHAQKAVEVFIAGGEE* |
| ⦗Top⦘ |